IGF2 Protein, Human

IGF2 Protein, Human is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone.

Insulin-like growth factor (IGF) modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. Human Insulin-like Growth factor-2 (IGF-II) is produced by osteoblasts, and its mitogenic effects are mediated by their binding to the IGF plasma membrane receptors. The IGF type 1 receptor binding to both IGF-I and IGF-II, is thought to be the predominate receptor involved in mediating the effects of these growth factors in most cell types, including osteoblasts^[1].

1.The ED₅₀ is <20 ng/mL as measured by FDCP-1 cells, corresponding to a specific activity of >5 × 10⁴ units/mg.
2.Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is 3.658 ng/mL, corresponding to a specific activity is 2.733×10⁵ units/mg.

• 
  Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED₅₀ for this effect is 3.658 ng/mL, corresponding to a specific activity is 2.733×10⁵ units/mg.

Human

E. coli

Tag Free

P01344-1 (A25-E91)

3481  [NCBI]

MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Approximately 7.6 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 25 mM Tris, pH 8.0 or PBS, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140(10):4699-705.  [Content Brief]