1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-13 Receptor
  5. IL-13Rα2
  6. IL-13R alpha 2 Protein, Mouse (HEK293, Fc)

IL-13R alpha 2 Protein, acting as a monomer, displays a strong binding affinity for interleukin-13 (IL-13). IL-13R alpha 2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-13R alpha 2 Protein, acting as a monomer, displays a strong binding affinity for interleukin-13 (IL-13). IL-13R alpha 2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

IL-13R alpha 2 protein, as a monomer, exhibits a high affinity for binding to interleukin-13 (IL-13).

Biological Activity

1. Measured by its ability to inhibit mIL13-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is typically ≤30 ng/mL in the presence of 4 ng/mL of mIL13.
2. Immobilized mIL13RA2-mFc(mIgG2a) at 10 μg/mL (100 μL/well) can bind IL13/Biotin, the EC50 of IL13/Biotin is 20-50 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-mFc

Accession

O88786-1 (L22-K334)

Gene ID
Molecular Construction
N-term
IL-13Rα2 (L22-K334)
Accession # O88786-1
mFc
C-term
Synonyms
Interleukin-13 receptor subunit alpha-2; IL-13R-alpha-2; IL-13RA2; CD213a2; IL13RA2; IL13R
AA Sequence

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Weight

Approximately 62.84 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-13R alpha 2 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-13R alpha 2 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P75830
Quantity:
MCE Japan Authorized Agent: