IL-13R alpha 2 Protein, Mouse (HEK293, Fc)

IL-13R alpha 2 Protein, acting as a monomer, displays a strong binding affinity for interleukin-13 (IL-13). IL-13R alpha 2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-mFc labeled tag.

IL-13R alpha 2 protein, as a monomer, exhibits a high affinity for binding to interleukin-13 (IL-13).

1. Measured by its ability to inhibit mIL13-dependent proliferation of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is typically ≤30 ng/mL in the presence of 4 ng/mL of mIL13.
2. Immobilized mIL13RA2-mFc(mIgG2a) at 10 μg/mL (100 μL/well) can bind IL13/Biotin, the EC₅₀ of IL13/Biotin is 20-50 ng/mL.

Mouse

HEK293

C-mFc

O88786-1 (L22-K334)

16165  [NCBI]

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

Approximately 62.84 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.