IL-13R alpha 2 Protein, Mouse (HEK293, His)

The IL-13R alpha 2 protein is a high-affinity receptor for interleukin 13 (IL-13) that acts as a decoy receptor and does not induce signaling upon IL-13 binding. Mice lacking this protein exhibit increased serum immunoglobulins, interferon gamma production, and bone marrow macrophage progenitor cell frequencies. IL-13R alpha 2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

IL-13R alpha 2 protein serves as a high-affinity receptor for interleukin 13 (IL-13) and functions as a decoy receptor, lacking the ability to induce signaling upon IL-13 binding. In mice lacking this protein, increased levels of serum immunoglobulins, immune-dependent interferon gamma production, and elevated bone marrow macrophage progenitor frequency are observed. Macrophages deficient in the encoded protein demonstrate reduced release of nitric oxide and IL-12 in response to lipopolysaccharide. Multiple transcript variants, encoding different isoforms, are generated through alternative splicing. The expression of IL-13R alpha 2 protein is biased in various tissues, including adult bladder and frontal lobe.

1.Measured by its ability to inhibit IL-13-dependent proliferation of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.017 μg/mL in the presence of 8 ng/mL of recombinant mouse IL-13, corresponding to a specific activity is 5.88×10⁴ units/mg.
2.Immobilized Mouse IL-13R2, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human IL-13, hFc Tag with the EC₅₀ of 6.6 ng/mL determined by ELISA.

• 
  Measured by its ability to inhibit IL-13-dependent proliferation of TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 0.017 μg/mL in the presence of 8 ng/mL of recombinant mouse IL-13, corresponding to a specific activity is 5.88×10₄ units/mg.

Mouse

HEK293

C-His

O88786-1/NP_032382.1 (L22-K334)

16165  [NCBI]

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK

40-60 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.