1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-23
  5. Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His)

Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His)

Cat. No.: HY-P77703
SDS COA Handling Instructions Technical Support

IL-23 alpha and IL-12 beta are the IL-23p19 and IL-12p40 subunits, respectively, composing IL-23 via heterodimerization manner. IL-23 binds to a heterodimeric receptor composed of IL-12RB1 and IL-23R, activates the Jak-Stat signaling cascade, acts on memory CD4(+) T cells preferentially. IL-23 also involves in activation of several pathways including p38 MAPK or NF-κB and promotes the production of pro-inflammatory cytokines such as interleukin-17A/IL17A. Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein is produced in HEK293 cells, with total length of 481 amino acids and a N-Terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-23 alpha and IL-12 beta are the IL-23p19 and IL-12p40 subunits, respectively, composing IL-23 via heterodimerization manner. IL-23 binds to a heterodimeric receptor composed of IL-12RB1 and IL-23R, activates the Jak-Stat signaling cascade, acts on memory CD4(+) T cells preferentially[1]. IL-23 also involves in activation of several pathways including p38 MAPK or NF-κB and promotes the production of pro-inflammatory cytokines such as interleukin-17A/IL17A[2]. Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein is produced in HEK293 cells, with total length of 481 amino acids and a N-Terminal His-tag.

Background

IL-23 alpha and IL-12 beta, also known as IL23p19 and IL12p40, respectively, and composing IL-23 in a heterodimerization manner, exerts proinflammatory effects and promotes angiogenesis[1][5].
IL-23 belongs to the IL-12 cytokine family together with IL-12 p35/p40, IL-27 EBI3/p28 and IL-35 EBI3/p35, and is produced by various immune cells such as dendritic cells and macrophages upon Toll-like receptor signaling in tissues[3].
IL-23 has a preference expression on memory CD4(+) T cells, and activates the Jak-Stat signaling cascade. IL-23 leads to IL-23 receptor phosphorylation and forms a docking site to trigger phosphorylation signal of STAT3 and STAT4[1].
IL-23 is a key factor perpetuating Th17 cell activation and cytokine production by binding IL-23 receptor to produce Th17 cytokines such as IL17 A, IL-17 F and IL-22[2].
IL-23 also acts function on natural killer cells, results interferon-γ secretion increasing and enhances antibody-dependent cellular cytotoxicity[4].
The sequence of amino acids in IL-23 alpha proteins of cynomolgus shows high similarity with human (97.88%) and is very different from mouse (74.6%) and rat (79.37%)
IL-23 facilitates development of inflammation in numerous other models of immune pathology where IL-12 had previously been implicated, including models of arthritis,intestinal inflammation, and psoriasis[6][7][8].

Biological Activity

Cynomolgus IL-23R, His Tag immobilized on CM5 Chip can bind Cynomolgus IL-23 alpha&Mouse IL-12 beta, His Tag with an affinity constant of 2.36 nM as determined in SPR assay (Biacore T200).

Species

Cynomolgus

Source

HEK293

Tag

N-His

Accession

A0A2K5TLV4 (V22-P189)&P43432 (M23-S335)

Gene ID
Molecular Construction
N-term
His
IL23A (V22-P189)
Accession # A0A2K5TLV4
C-term
N-term
IL12B (M23-S335)
Accession # P43432-1
C-term
Synonyms
IL23 alpha; IL12 beta; IL23 alpha&IL12 beta
AA Sequence

VPGGSSPAWAQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIRQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSPSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Weight

22 ( Cynomolgus IL23 alpha)&40-50 (Mouse IL12 beta) kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293, His)
Cat. No.:
HY-P77703
Quantity:
MCE Japan Authorized Agent: