IL-27 Protein, Mouse (HEK293, His)

IL-27 (Interleukin-27) is a heterodimeric cytokine of the IL-12 family, composed of two subunits, EBI3 (Epstein-Barr-virus-induced molecule 3) and p28^[1]. IL-27 enhances the development, proliferation, and cytotoxic activity of CD8⁺ T cells, thereby indirectly promoting anti-tumor immunity^{[ 2]}. IL-27 Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of two subunits, EBI3 (IL27B) (209 amino acids (Y19-P228)) and IL27A (205 amino acids (F29-S234)), and is produced by HEK293 cells.

IL-27 is mainly produced by cells of myeloid origin such as monocytes, macrophages, dendritic cells, and microglial cells, in response to stimuli acting through Toll-like receptors or TNF-R-family members^[3].
The amino acid sequence of human IL-27 protein has low homology for mouse IL-27 protein.
IL-27 acts through a heterodimer receptor consisting of IL-27Rα (WSX1) and gp130 chains, activates the JAK/STAT signaling pathway, which mainly involves STAT1 and STAT3 phosphorylation. STAT3 activation by IL-27 induces the expression of SOCS3, which inhibits further IL-27 signaling in a negative feedback loop, through inhibition of JAK activity^[3].
IL-27 plays multiple roles in proinflammatory and anti-inflammatory immune responses. IL-27 enhances NF-κB/AP-1 activity and increases IL-12p40, TNF-α, and IL-6 production, increases TLR4 and TLR5 expression^[5]. IL-27 exerts inhibitory effects upon hPMSC adherence and proliferation, and promotes migration of hPMSCs. Besides, IL-27 can upregulate PDL1 expression and enhance the regulatory effects of hPMSCs on Th1 and Th2 cell differentiations and IL-10 secretion from CD4+T cells^[6]. IL-27 induces the proliferation and differentiation in hematopoietic stem cells^[7]. IL-27 increases IL-10 levels and the expression of p-STAT1, p-STAT3^[8]. IL-27 promotes the development and differentiation of CD4+IL-10+ T cells^[9].

IL-27 (mouse) (10 ng/mL; 7, 14, 21 days) enhances the differentiation of CD34−KSL HSCs^[7].
IL-27 (mouse) (2, 10, 25, 50 ng) increases the expression of p-STAT1, p-STAT3^[8].
IL-27 (mouse) (20 ng/ml) significantly up-regulates the differentiation of CD4+IL-10+ T cells^[9].

IL-27 (mouse) (500, 1000 ng; p.o.; daily for 5 days) increases IL-10 levels in the circulation but not in the distal colon in Rag-/- mice ^[8].
IL-27 (mouse) (200 ng/mouse; i.p.; daily for 7 days) up-regulates CD4+IL-10+ T cells and suppress inflammation in NOD mice^[9].

Mouse

HEK293

C-6*His

O35228 (Y19-P228) & Q8K3I6 (F29-S234)

50498  [NCBI]&246779  [NCBI]

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP&FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

50-65 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS,2 mM EDTA, 5% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. [2]Kourko O, et al. IL-27, IL-30, and IL-35: A Cytokine Triumvirate in Cancer. Front Oncol. 2019 Oct 1;9:969.  [Content Brief]

  [2]. Fabbi M, et al. Dual Roles of IL-27 in Cancer Biology and Immunotherapy. Mediators Inflamm. 2017;2017:3958069.  [Content Brief]

  [3]. Pflanz S, et al. IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4+ T cells. Immunity. 2002 Jun;16(6):779-90.  [Content Brief]

  [4]. Petes C, et al. IL-27 amplifies cytokine responses to Gram-negative bacterial products and Salmonella typhimurium infection. Sci Rep. 2018 Sep 12;8(1):13704.  [Content Brief]

  [5]. Xu F, et al. IL-27 regulates the adherence, proliferation, and migration of MSCs and enhances their regulatory effects on Th1 and Th2 subset generations. Immunol Res. 2017 Aug;65(4):903-912.  [Content Brief]

  [6]. [7]Seita J, et al. Interleukin-27 directly induces differentiation in hematopoietic stem cells. Blood. 2008 Feb 15;111(4):1903-12.  [Content Brief]

  [7]. Hanson ML, et al. Oral delivery of IL-27 recombinant bacteria attenuates immune colitis in mice. Gastroenterology. 2014 Jan;146(1):210-221.e13.  [Content Brief]

  [8]. Qi J, et al. IL-27 Regulated CD4+IL-10+ T Cells in Experimental Sjögren Syndrome. Front Immunol. 2020 Aug 11;11:1699.  [Content Brief]