IL-5 Protein, Mouse

IL-5 Protein, Mouse is a hematopoietic growth factor expressed in Th2, mast cells and eosinophils.

Interleukin-5 (IL-5), which is produced primarily by type 2 T helper lymphocytes (Th2), is an eosinophil differentiation and activation factor. Antagonism of IL-5 activity is being explored as a potential treatment of a number of disease conditions associated with eosinophils in animal models^[1]. Interleukin-5 (IL-5) which was previously named T cell replacing factor, B cell growth and differentiation factor, colony forming unit growth stimulating factor and eosinophil differentiation factor is produced predominantly by T cells. Mouse IL-5 is active as a growth factor on mouse but not human B cells. Mouse IL-5 stimulates the production and secretion of IgM and IgA by B cells in synergism with bacterial endotoxins. IL-5 has also been found to promote the generation of cytotoxic cells from human and mouse thymocytes. IL-5 is a potent growth promoter of early haemopoeitic progenitor cells. It stimulates the production of eosinophits from mouse, human and sheep in vitro and controls the production of eosinophils in vivo. Mouse IL-5 possesses eosinophil potentiating activity^[2].

The ED₅₀ is <2.0 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >5.0 × 10⁵ units/mg.

Mouse

E. coli

Tag Free

P04401 (M21-G133)

16191  [NCBI]

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Approximately 26.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yang S, et al. Canine interleukin-5: molecular characterization of the gene and expression of biologically active recombinant protein. J Interferon Cytokine Res. 2001 Jun;21(6):361-7.  [Content Brief]

  [2]. Seow HF, et al. Cloning and sequencing of an ovine interleukin-5 cDNA. DNA Seq. 1996;6(6):331-5.  [Content Brief]