1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-9R
  5. IL-9R Protein, Rat (HEK293, His)

Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. IL-9R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-9R protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 35 In-stock
10 μg USD 100 In-stock
50 μg USD 280 In-stock
100 μg   Get quote  

Get it by May 14 for select sizes. Order within 23 hrs 13 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. IL-9R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-9R protein, expressed by HEK293 , with C-His labeled tag.

Background

Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. Interleukin 9 receptor enables interleukin-9 binding activity and interleukin-9 receptor activity. Interleukin 9 receptor is involved in positive regulation of cell growth and located in cell surface and plasma membrane[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED50 for this effect is 77.69 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED50 for this effect is 77.69 ng/mL.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

G3V8S1 (M1-A270)

Gene ID

/

Molecular Construction
N-term
IL-9R (M1-A270)
Accession # G3V8S1
His
C-term
Synonyms
Interleukin-9 receptor; IL-9R; CD129; IL9R
AA Sequence

MALGRCFPEGCTVEGAAVKQVSWFLIYSCVCSCVCWGVSVPAQEGGRKAGTFTCFSNSVFRIDCHWSAPEPGSRAWLLFTSNQVTDIKHKCTFWDSRCTLVLPKEEAFLPFDNFTITLHRCVMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGISFGLEPLITSLSYELAFKRQEEAWEQARLKDRIVGVTWLVLEAIELNPDTIYEARLRVQMALESYDDKTEGEYYKSHWSEWSQSVSFPSPRRKTQGLLIPRWQGSA

Molecular Weight

Approximately 33-40 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-9R Protein, Rat (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-9R Protein, Rat (HEK293, His)
Cat. No.:
HY-P76437
Quantity:
MCE Japan Authorized Agent: