1. Recombinant Proteins
  2. Others
  3. ISCU Protein, Human (Sf9, His)

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1). ISCU Protein, Human (Sf9, His) is the recombinant human-derived ISCU protein, expressed by Sf9 insect cells , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 55 In-stock
50 μg USD 250 In-stock
100 μg   Get quote  

Get it by June 3 for select sizes. Order within 12 hrs 30 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1). ISCU Protein, Human (Sf9, His) is the recombinant human-derived ISCU protein, expressed by Sf9 insect cells , with N-6*His labeled tag.

Background

ISCU, a pivotal mitochondrial scaffold protein within the core iron-sulfur cluster (ISC) assembly complex, serves as the structural foundation for the assembly of [2Fe-2S] clusters. In the intricate process of de novo synthesis of [2Fe-2S] clusters, initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1), ISCU plays a central role by receiving persulfide in a FXN-dependent manner. Stabilization of this complex is facilitated by FDX2, providing reducing equivalents for efficient [2Fe-2S] cluster assembly. Subsequently, ISCU acts as a crucial intermediary, transferring the assembled [2Fe-2S] cluster to chaperone proteins, including HSCB, HSPA9, and GLRX5. Notably, ISCU exhibits dynamic conformational states, alternating between structured (S) and disordered (D) forms. Its zinc-dependent modulation of NFS1 desulfurase activity and influence on the interaction between FXN and the cysteine desulfurase complex further underscore its multifaceted role. Additionally, as a cytoplasmic scaffold protein, ISCU contributes to the structural framework of the cytoplasmic ISC assembly complex, participating in the assembly of Fe-S clusters and potentially contributing to cytoplasmic iron-sulfur protein biogenesis.

Species

Human

Source

Sf9 insect cells

Tag

N-6*His

Accession

Q9H1K1-1 (Y35-K167)

Gene ID
Molecular Construction
N-term
10*His
ISCU (Y35-K167)
Accession # Q9H1K1-1
Myc
C-term
Synonyms
2310020H20Rik; HML; hnifU; Iron sulfur cluster assembly enzyme ISCU mitochondrial; Iron sulfur cluster scaffold homolog E. coli; ; Iron sulfur cluster scaffold homolog; Iron-sulfur cluster assembly enzyme ISCU; Iscu; IscU iron sulfur cluster scaffold homolog; ISCU_HUMAN; ISU2; MGC74517; mitochondrial; NIFU; NifU like N terminal domain containing; NifU like N terminal domain containing protein; NifU like protein; NifU-like N-terminal domain-containing protein; NifU-like protein; NIFUN; Nitrogen fixation cluster like; OTTHUMP00000238760; OTTHUMP00000238761; OTTHUMP00000238762; OTTHUMP00000238764; OTTHUMP00000238765
AA Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of PBS, pH 7.4, 10% Glycerol, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ISCU Protein, Human (Sf9, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ISCU Protein, Human (Sf9, His)
Cat. No.:
HY-P72066
Quantity:
MCE Japan Authorized Agent: