ISCU Protein, Human (Sf9, His)

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1). ISCU Protein, Human (Sf9, His) is the recombinant human-derived ISCU protein, expressed by Sf9 insect cells , with N-6*His labeled tag.

ISCU, a pivotal mitochondrial scaffold protein within the core iron-sulfur cluster (ISC) assembly complex, serves as the structural foundation for the assembly of [2Fe-2S] clusters. In the intricate process of de novo synthesis of [2Fe-2S] clusters, initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1), ISCU plays a central role by receiving persulfide in a FXN-dependent manner. Stabilization of this complex is facilitated by FDX2, providing reducing equivalents for efficient [2Fe-2S] cluster assembly. Subsequently, ISCU acts as a crucial intermediary, transferring the assembled [2Fe-2S] cluster to chaperone proteins, including HSCB, HSPA9, and GLRX5. Notably, ISCU exhibits dynamic conformational states, alternating between structured (S) and disordered (D) forms. Its zinc-dependent modulation of NFS1 desulfurase activity and influence on the interaction between FXN and the cysteine desulfurase complex further underscore its multifaceted role. Additionally, as a cytoplasmic scaffold protein, ISCU contributes to the structural framework of the cytoplasmic ISC assembly complex, participating in the assembly of Fe-S clusters and potentially contributing to cytoplasmic iron-sulfur protein biogenesis.

Human

Sf9 insect cells

N-6*His

Q9H1K1-1 (Y35-K167)

23479  [NCBI]

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of PBS, pH 7.4, 10% Glycerol, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.