LD78-beta/CCL3L1 Protein, Human

LD78-beta/CCL3L1 Protein, Human is a potent ligand for the HIV-1 co-receptor CCR5, which is essential for viral entry into human host cells.

CCL3L1 is the most potent known ligand for CC chemokine receptor 5 (CCR5), the major coreceptor for HIV, and it is a dominant HIV-suppressive chemokine. Possession of a CCL3L1 copy number lower than the population average is associated with markedly enhanced HIV/acquired immunodeficiency syndrome (AIDS) susceptibility^[1].

1.The ED₅₀ is <0.4 μg/mL as measured by CHO cells, corresponding to a specific activity of >2.5 × 10³ units/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED₅₀ for this effect is 0.3247 ng/mL corresponding to a specific activity is 3.080×10⁶ U/mg.

• 
  Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED₅₀ for this effect is 0.3247 ng/mL corresponding to a specific activity is 3.080×10⁶ U/mg.

Human

E. coli

Tag Free

P16619 (A24-A93)

6349  [NCBI]

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Approximately 13.45 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Urban TJ, et al. CCL3L1 and HIV/AIDS susceptibility. Nat Med. 2009 Oct;15(10):1110-2.  [Content Brief]