1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. LD78-beta/CCL3L1 Protein, Human

LD78-beta/CCL3L1 Protein, Human is a potent ligand for the HIV-1 co-receptor CCR5, which is essential for viral entry into human host cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg USD 60 In-stock
10 μg USD 168 In-stock
50 μg USD 410 In-stock
100 μg USD 693 In-stock
> 100 μg   Get quote  

Get it tomorrow April 2 by noon. Order within 4 hrs 17 mins.

* Please select Quantity before adding items.

LD78-beta/CCL3L1 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LD78-beta/CCL3L1 Protein, Human is a potent ligand for the HIV-1 co-receptor CCR5, which is essential for viral entry into human host cells.

Background

CCL3L1 is the most potent known ligand for CC chemokine receptor 5 (CCR5), the major coreceptor for HIV, and it is a dominant HIV-suppressive chemokine. Possession of a CCL3L1 copy number lower than the population average is associated with markedly enhanced HIV/acquired immunodeficiency syndrome (AIDS) susceptibility[1].

Biological Activity

1.The ED50 is <0.4 μg/mL as measured by CHO cells, corresponding to a specific activity of >2.5 × 103 units/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is <0.4 ng/mL corresponding to a specific activity is 2.5×106 U/mg.

  • Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR5. The ED50 for this effect is 0.3247 ng/mL corresponding to a specific activity is 3.080×106 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P16619 (A24-A93)

Gene ID
Molecular Construction
N-term
CCL3L1 (A24-A93)
Accession # P16619
C-term
Synonyms
rHuLD78β/CCL3L1; C-C motif chemokine 3-like 1; SCYA3L1
AA Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Molecular Weight

Approximately 13.45 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

LD78-beta/CCL3L1 Protein, Human Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LD78-beta/CCL3L1 Protein, Human
Cat. No.:
HY-P7231
Quantity:
MCE Japan Authorized Agent: