LILRB1/CD85j/ILT2 Protein, Rhesus Macaque (HEK293, His)

LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes and recognizes HLA-class I and human cytomegalovirus UL18^[1]. LILRB1/CD85j/ILT2 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LILRB1/CD85j/ILT2 Protein, Rhesus Macaque (HEK293, His) is 440 a.a., with molecular weight of 60-85 kDa.

LILRB1/CD85j/ILT2 Protein a member of the leukocyte immunoglobulin-like receptor (LIR) family which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs)^[2]. LILRB1/CD85j/ILT2 Protein is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity^[3].

Measured by its ability to inhibit proliferation of Jurkat human T-lymphocyte leukemia cells. The ED₅₀ this effect is 0.9206 μg/ml, corresponding to a specific activity is 1.09×10³ units/mg.

• 
  Measured by its ability to inhibit proliferation of Jurkat human T-lymphocyte leukemia cells. The ED₅₀ for this effect is 0.9206 μg/mL, corresponding to a specific activity is 1.09×10³ units/mg.

Rhesus Macaque

HEK293

C-6*His

F7H3G7 (S17-H456)

692340

SRTRVQAGTFPKPTLWAEPGSMISKGSPVTLRCQGSLPVQDYRLQREKKTASWVRRIQQELVKKGYFPIASITSEHAGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVTLQCDSQVAGGFVLCKEGEDEHPQCLNSQPHTRGSSRAVFSVGPVSPSRRWSYRCYGYDSRSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYNRFALYKEGERDFLQRPGRQPQAGLSQANFLLDPVRRSHGGQYRCSGAHNLSSEWSAPSDPLDILIAGQIRGRPSLLVQPGPTVVSGENVTLLCQSSWQFHVFLLTQAGAADAHLHLRSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSHSSDSYLLSIPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLTPTGSDPQSGLGRH

60-85 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.