Lumican/LUM Protein, Mouse (HEK293, His)

Lumican/LUM protein binds specifically to laminin.Lumican/LUM Protein, Mouse (HEK293, His) is the recombinant mouse-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag.

Lumican/LUM protein exhibits a specific binding affinity for laminin.

Measured by the ability of the immobilized protein to support the adhesion of A375 cells. When 5×10⁴ cells per well are added to LUM coated plates (10 μg/mL, 100 μL/well) 52.73% will adhere after 30 minutes at 37°C.

Mouse

HEK293

C-6*His

P51885 (Q19-N338)

17022  [NCBI]

QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN

40-60 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.