1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MCP-1/CCL2
  6. MCP-1/CCL2 Protein, Rat (HEK293, C-His)

MCP-1/CCL2 Protein, Rat (HEK293, C-His)

Cat. No.: HY-P7236
SDS COA Handling Instructions

MCP-1/CCL2 Protein, Rat (HEK293, His) is a small cytokine that belongs to the CC chemokine family.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MCP-1/CCL2 Protein, Rat (HEK293, His) is a small cytokine that belongs to the CC chemokine family.

Background

CCL2 is produced by a variety of cell types, either constitutively or after induction by oxidative stress, cytokines, or growth factors. CCL2 is produced by many cell types, including endothelial, fibroblasts, epithelial, smooth muscle, mesangial, astrocytic, monocytic, and microglial cells. CCL2 regulates the migration and infiltration of monocytes, memory T lymphocytes, and natural killer (NK) cells[1]. The chemokine CCL2 and its main chemokine receptor CCR2 have been implicated in the pathogenesis of several different disease processes, including vascular permeability and attraction of immune cells during metastasis, a number of different neurological disorders, autoimmune disease, obesity, and atherosclerosis[2].

In Vivo

CCL2 (s.c., 4 or 8 μg/kg, daily, 5 days) has no effect on food intake, water intake, weight, or spontaneous abortion while increases CCL2/CCR2 and melanin-concentrating hormone (MCH) expression and cell density in progeny lateral hypothalamus in pregnant rats. Also, CCL2 increases ethanol intake and anxiety-like behavior and decreases motor activity in female and male adolescent offspring, and this effect is significantly stronger in females[4].

Biological Activity

The ED50 is <0.3 μg/mL as measured by CHO-K1/Gα15/rCCR2/THP-1 cells (human Gα15 and rat CCR2 stably expressed in CHO-K1 cells).

  • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells.The ED50for this effect is 5.648 ng/mL, corresponding to a specific activity is 1.771×105 U/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P14844 (Q24-N148)

Gene ID
Molecular Construction
N-term
CCL2 (Q24-N148)
Accession # P14844
6*His
C-term
Synonyms
rRtMCP-1/CCL2; C-C motif chemokine 2; MCAF; MCP-1; SCYA2
AA Sequence

QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN

Molecular Weight

Approximately 27-43 kDa under reducing SDS-PAGE due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MCP-1/CCL2 Protein, Rat (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-1/CCL2 Protein, Rat (HEK293, C-His)
Cat. No.:
HY-P7236
Quantity:
MCE Japan Authorized Agent: