1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. MDH1 Protein, Human (His)

Multiple studies have shown that the MDH1 protein plays a crucial role in cellular metabolism, catalyzing the reduction of aromatic α-keto acids in the presence of NADH. It plays an important role in the malate-aspartate shuttle and the tricarboxylic acid cycle, which is essential for supplying mitochondrial NADH for oxidative phosphorylation. MDH1 Protein, Human (His) is the recombinant human-derived MDH1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Multiple studies have shown that the MDH1 protein plays a crucial role in cellular metabolism, catalyzing the reduction of aromatic α-keto acids in the presence of NADH. It plays an important role in the malate-aspartate shuttle and the tricarboxylic acid cycle, which is essential for supplying mitochondrial NADH for oxidative phosphorylation. MDH1 Protein, Human (His) is the recombinant human-derived MDH1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

The MDH1 protein, also known as malate dehydrogenase 1, plays multifaceted roles in cellular metabolism. It catalyzes the reduction of aromatic alpha-keto acids in the presence of NADH, a process integral to various metabolic pathways. MDH1 is crucial for the malate-aspartate shuttle and the tricarboxylic acid cycle, contributing to the supply of mitochondrial NADH for oxidative phosphorylation, a key step in cellular energy production. Additionally, MDH1 catalyzes the reduction of 2-oxoglutarate to 2-hydroxyglutarate, a reaction associated with elevated reactive oxygen species (ROS). The intricate functions of MDH1 highlight its significance in maintaining cellular redox balance, energy metabolism, and the regulation of reactive oxygen species.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P40925-1 (S2-A334)

Gene ID
Molecular Construction
N-term
MDH1 (S2-A334)
Accession # P40925-1
6*His
C-term
Synonyms
rHuMalate dehydrogenase cytoplasmic/MDH1, His; Malate Dehydrogenase Cytoplasmic; Cytosolic Malate Dehydrogenase; Diiodophenylpyruvate Reductase; MDH1; MDHA
AA Sequence

SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Molecular Weight

Approximately 38 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MDH1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDH1 Protein, Human (His)
Cat. No.:
HY-P70349
Quantity:
MCE Japan Authorized Agent: