MDH1 Protein, Human (His)

Multiple studies have shown that the MDH1 protein plays a crucial role in cellular metabolism, catalyzing the reduction of aromatic α-keto acids in the presence of NADH. It plays an important role in the malate-aspartate shuttle and the tricarboxylic acid cycle, which is essential for supplying mitochondrial NADH for oxidative phosphorylation. MDH1 Protein, Human (His) is the recombinant human-derived MDH1 protein, expressed by E. coli , with C-6*His labeled tag.

The MDH1 protein, also known as malate dehydrogenase 1, plays multifaceted roles in cellular metabolism. It catalyzes the reduction of aromatic alpha-keto acids in the presence of NADH, a process integral to various metabolic pathways. MDH1 is crucial for the malate-aspartate shuttle and the tricarboxylic acid cycle, contributing to the supply of mitochondrial NADH for oxidative phosphorylation, a key step in cellular energy production. Additionally, MDH1 catalyzes the reduction of 2-oxoglutarate to 2-hydroxyglutarate, a reaction associated with elevated reactive oxygen species (ROS). The intricate functions of MDH1 highlight its significance in maintaining cellular redox balance, energy metabolism, and the regulation of reactive oxygen species.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

C-6*His

P40925-1 (S2-A334)

4190  [NCBI]

SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Approximately 38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.