1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. MUC-1/CD227 Epithelial cell CD Proteins
  4. Mucin-1/MUC1 Protein, Human (HEK293, mFc)

Mucin-1/MUC1 Protein, Human (HEK293, mFc)

Cat. No.: HY-P78774
COA Handling Instructions

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293, mFc) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $48 In-stock
10 μg $77 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293, mFc) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

The Mucin-1/MUC1 protein exhibits diverse functional roles: the alpha subunit possesses cell adhesive properties and functions as both an adhesion and an anti-adhesion protein, potentially forming a protective layer on epithelial cells against bacterial and enzyme attacks. Simultaneously, the beta subunit, with its C-terminal domain, engages in cell signaling through phosphorylations and protein-protein interactions. Mucin-1/MUC1 modulates signaling in ERK, SRC, and NF-kappa-B pathways, influencing the Ras/MAPK pathway in activated T-cells. Additionally, it plays a role in promoting tumor progression, regulating TP53-mediated transcription, and determining cell fate in the genotoxic stress response. Notably, in conjunction with KLF4, Mucin-1/MUC1 binds to the PE21 promoter element of TP53, thereby repressing TP53 activity and contributing to the intricate network of cellular functions.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human MUC1 is present at 1 μg/mL, can bind Human MUC1 Antibody. The ED50 for this effect is 5.59 ng/mL.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

P15941-1 (S1098-G1158)

Gene ID
Molecular Construction
N-term
Mucin-1 (S1098-G1158)
Accession # P15941-1
mFc
C-term
Synonyms
Mucin 1; MUC1; CD227; EMA; H23AG; KL-6; MAM6; MUC-1; SEC; MUC-1; X; MUC1; ZD; PEM; PEMT; PUM; CA15-3; Episialin
AA Sequence

SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG

Molecular Weight

Approximately 38-43 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Mucin-1/MUC1 Protein, Human (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mucin-1/MUC1 Protein, Human (HEK293, mFc)
Cat. No.:
HY-P78774
Quantity:
MCE Japan Authorized Agent: