1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Biotinylated Proteins
  3. MUC-1/CD227 Epithelial cell CD Proteins
  4. Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P72399
Data Sheet Handling Instructions Technical Support

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 144 a.a., with molecular weight of 55-75 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 144 a.a., with molecular weight of 55-75 kDa.

Background

The Mucin-1/MUC1 protein exhibits diverse functional roles: the alpha subunit possesses cell adhesive properties and functions as both an adhesion and an anti-adhesion protein, potentially forming a protective layer on epithelial cells against bacterial and enzyme attacks. Simultaneously, the beta subunit, with its C-terminal domain, engages in cell signaling through phosphorylations and protein-protein interactions. Mucin-1/MUC1 modulates signaling in ERK, SRC, and NF-kappa-B pathways, influencing the Ras/MAPK pathway in activated T-cells. Additionally, it plays a role in promoting tumor progression, regulating TP53-mediated transcription, and determining cell fate in the genotoxic stress response. Notably, in conjunction with KLF4, Mucin-1/MUC1 binds to the PE21 promoter element of TP53, thereby repressing TP53 activity and contributing to the intricate network of cellular functions.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

P15941-11 (P24-G167)

Gene ID
Molecular Construction
N-term
Mucin-1 (P24-G167)
Accession # P15941-11
hFc-Avi
C-term
Synonyms
MUC-1; CA 15-3; Carcinoma-associated mucin; Episialin; H23AG; Krebs von den Lungen-6; KL-6; PEMT; PUM; PEM; EMA; CD227; MUC1 
AA Sequence

PKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG

Molecular Weight

55-75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P72399
Quantity:
MCE Japan Authorized Agent: