1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens Biotinylated Proteins
  3. MUC-1/CD227 Epithelial cell CD Proteins
  4. Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P72399
Data Sheet Handling Instructions Technical Support

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg USD 275 Ask For Quote & Lead Time
100 μg USD 745 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

The Mucin-1/MUC1 protein exhibits diverse functional roles: the alpha subunit possesses cell adhesive properties and functions as both an adhesion and an anti-adhesion protein, potentially forming a protective layer on epithelial cells against bacterial and enzyme attacks. Simultaneously, the beta subunit, with its C-terminal domain, engages in cell signaling through phosphorylations and protein-protein interactions. Mucin-1/MUC1 modulates signaling in ERK, SRC, and NF-kappa-B pathways, influencing the Ras/MAPK pathway in activated T-cells. Additionally, it plays a role in promoting tumor progression, regulating TP53-mediated transcription, and determining cell fate in the genotoxic stress response. Notably, in conjunction with KLF4, Mucin-1/MUC1 binds to the PE21 promoter element of TP53, thereby repressing TP53 activity and contributing to the intricate network of cellular functions.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

P15941-11 (P24-G167)

Gene ID
Molecular Construction
N-term
Mucin-1 (P24-G167)
Accession # P15941-11
hFc-Avi
C-term
Synonyms
MUC-1; CA 15-3; Carcinoma-associated mucin; Episialin; H23AG; Krebs von den Lungen-6; KL-6; PEMT; PUM; PEM; EMA; CD227; MUC1 
AA Sequence

PKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG

Molecular Weight

55-75 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mucin-1/MUC1 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P72399
Quantity:
MCE Japan Authorized Agent: