nAChRα5 Protein, Human (HEK293, His)

The nAChRα5 protein induces significant conformational changes in all subunits upon acetylcholine binding, leading to the opening of ion-conducting channels in the plasma membrane. nAChRα5, composed of α and non-α (β) subunits, interacts with LYPD6 to reveal complex regulatory mechanisms in neuronal acetylcholine receptors. nAChRα5 Protein, Human (HEK293, His) is the recombinant human-derived nAChRα5 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of nAChRα5 Protein, Human (HEK293, His) is 232 a.a., with molecular weight of 35-40 kDa.

Upon acetylcholine binding, nAChRα5 Protein initiates a substantial conformational change that influences all subunits, ultimately resulting in the opening of an ion-conducting channel across the plasma membrane. The neuronal AChR is evidently comprised of two distinct types of subunits: the alpha subunits and the non-alpha β subunits. Notably, nAChRα5 Protein engages in interactions with LYPD6, as documented in studies. This molecular interaction sheds light on the intricate regulatory mechanisms underlying the functionality of neuronal acetylcholine receptors, emphasizing the dynamic nature of their conformational changes and their significance in ion channel activation.

Human

HEK293

C-6*His

P30532/NP_000736.2 (R23-T254)

1138  [NCBI]

RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYT

35-40 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.