NEDD8 Protein, Human

NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free. The total length of NEDD8 Protein, Human is 76 a.a., with molecular weight of ~9.0 kDa.

NEDD8, an ubiquitin-like protein, assumes a pivotal role in regulating cell cycle progression and embryogenesis by conjugating to a select group of cellular proteins, including cullins and p53/TP53. The attachment of NEDD8 to cullins is essential for recruiting the E2 enzyme to the cullin-RING-based E3 ubiquitin-protein ligase complex, facilitating the polyubiquitination and subsequent proteasomal degradation of regulatory proteins such as cyclins. In the case of p53/TP53, NEDD8 conjugation inhibits its transcriptional activity. This covalent attachment process relies on prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. NEDD8 also engages in direct interactions with AHR and NUB1, further expanding its regulatory network.

Human

E. coli

Tag Free

Q15843 (M1-G76)

4738  [NCBI]

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG

Approximately 9.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 250 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.