1. Recombinant Proteins
  2. Others
  3. NEDD8 Protein, Human

NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NEDD8 is an important ubiquitin-like protein that plays a key role in cell cycle regulation and embryogenesis by binding to specific proteins such as cullin and p53/TP53. Its binding to cullin is critical for recruiting E2 enzymes to the cullin-RING-based E3 ubiquitin-protein ligase complex, thereby enabling degradation of regulatory proteins. NEDD8 Protein, Human is the recombinant human-derived NEDD8 protein, expressed by E. coli , with tag free.

Background

NEDD8, an ubiquitin-like protein, assumes a pivotal role in regulating cell cycle progression and embryogenesis by conjugating to a select group of cellular proteins, including cullins and p53/TP53. The attachment of NEDD8 to cullins is essential for recruiting the E2 enzyme to the cullin-RING-based E3 ubiquitin-protein ligase complex, facilitating the polyubiquitination and subsequent proteasomal degradation of regulatory proteins such as cyclins. In the case of p53/TP53, NEDD8 conjugation inhibits its transcriptional activity. This covalent attachment process relies on prior activation by the E1 complex UBE1C-APPBP1 and linkage to the E2 enzyme UBE2M. NEDD8 also engages in direct interactions with AHR and NUB1, further expanding its regulatory network.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q15843 (M1-G76)

Gene ID
Molecular Construction
N-term
NEDD8 (M1-G76)
Accession # Q15843
C-term
Synonyms
Neural precursor cell expressed developmentally down-regulated protein 8; NEDD8; Neddylin; Ubiquitin-like protein Nedd8
AA Sequence

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG

Molecular Weight

Approximately 9.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 250 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

NEDD8 Protein, Human Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NEDD8 Protein, Human
Cat. No.:
HY-P70843
Quantity:
MCE Japan Authorized Agent: