NKp30/NCR3 Protein, Human (120a.a, HEK293, His)

NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (120a.a, HEK293, His) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-6*His labeled tag.

The NKp30/NCR3 protein serves as a cell membrane receptor on natural killer (NK) cells, becoming activated upon binding to extracellular ligands such as BAG6 and NCR3LG1. This activation stimulates NK cell cytotoxicity directed towards neighboring cells producing these ligands, thereby controlling NK cell cytotoxicity against various targets, including tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that did not acquire a mature phenotype but also induces the release of TNFA and IFNG by NK cells. This, in turn, promotes the maturation of myeloid dendritic cells. In its unliganded form, NKp30/NCR3 exists as a homodimer and interacts with CD3Z, NCR3LG1, and BAG6, highlighting its role as a multifaceted regulator in immune responses and NK cell-mediated cytotoxicity.

Human

HEK293

C-6*His

O14931-1 (L19-T138)

259197  [NCBI]

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT

20-31 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.