1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins
  4. CD337/NCR3
  5. NKp30/NCR3 Protein, Human (120a.a, HEK293, His)

NKp30/NCR3 Protein, Human (120a.a, HEK293, His)

Cat. No.: HY-P72506
SDS COA Handling Instructions Technical Support

NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (120a.a, HEK293, His) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NKp30/NCR3 protein is a cell membrane receptor on NK cells and is activated by binding to ligands such as BAG6 and NCR3LG1. This activation enhances NK cell cytotoxicity against neighboring cells that produce these ligands, including tumor cells. NKp30/NCR3 Protein, Human (120a.a, HEK293, His) is the recombinant human-derived NKp30/NCR3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The NKp30/NCR3 protein serves as a cell membrane receptor on natural killer (NK) cells, becoming activated upon binding to extracellular ligands such as BAG6 and NCR3LG1. This activation stimulates NK cell cytotoxicity directed towards neighboring cells producing these ligands, thereby controlling NK cell cytotoxicity against various targets, including tumor cells. The engagement of NCR3 by BAG6 not only enhances NK cell-mediated killing of myeloid dendritic cells (DCs) that did not acquire a mature phenotype but also induces the release of TNFA and IFNG by NK cells. This, in turn, promotes the maturation of myeloid dendritic cells. In its unliganded form, NKp30/NCR3 exists as a homodimer and interacts with CD3Z, NCR3LG1, and BAG6, highlighting its role as a multifaceted regulator in immune responses and NK cell-mediated cytotoxicity.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O14931-1 (L19-T138)

Gene ID
Molecular Construction
N-term
NKp30 (L19-T138)
Accession # O14931-1
6*His
C-term
Synonyms
NCR3 Protein; Natural Cytotoxicity Triggering Receptor 3; NCR3; CD337; 1C7; LY117
AA Sequence

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT

Molecular Weight

20-31 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NKp30/NCR3 Protein, Human (120a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKp30/NCR3 Protein, Human (120a.a, HEK293, His)
Cat. No.:
HY-P72506
Quantity:
MCE Japan Authorized Agent: