Noggin Protein, Human (HEK293, His)

Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Human (HEK293, His) is the recombinant human-derived Noggin protein, expressed by HEK293 , with C-His labeled tag. The total length of Noggin Protein, Human (HEK293, His) is 205 a.a., with molecular weight of ~30 kDa.

Noggin protein emerges as a crucial inhibitor in the intricate realm of bone morphogenetic proteins (BMP) signaling, playing indispensable roles in neural tube and somite growth, as well as contributing to the intricate processes of cartilage morphogenesis and joint formation. Operating through its homodimeric structure, Noggin establishes a significant interaction with GDF5, and likely GDF6, exerting its inhibitory influence on chondrocyte differentiation. This molecular interplay underscores Noggin's pivotal position in regulating key aspects of embryonic development, emphasizing its nuanced involvement in sculpting the intricate patterns and structures critical for proper growth and morphogenesis.

Measured by its ability to inhibit recombinant human BMP4-induced alkaline phosphatase production by MC3T3-E1 cells. The ED₅₀ for this effect is typically 0.01-0.3 μg/mL in the presence of 25 ng/mL of recombinant human BMP4.

Human

HEK293

C-His

Q13253/NP_005441.1 (Q28-C232)

9241  [NCBI]

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 30 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.