Noggin Protein, Mouse (CHO)

Noggin Protein, Mouse (CHO) is a bone morphogenetic protein (BMP) antagonist.

Mammalian noggin is remarkably similar in its sequence to Xenopus noggin, and is similarly active in induction assays performed on Xenopus embryo tissues. In the adult mammal, noggin is most notably expressed in the nervous system^[1]. Noggin is a bone morphogenetic protein (BMP) antagonist expressed in Spemann's organizer. Murine Noggin is expressed in condensing cartilage and immature chondrocytes. In mice lacking Noggin, cartilage condensations initiated normally but developed hyperplasia, and initiation of joint development failed^[2]. Noggin protein binds BMP4with high affinity and can abolish BMP4 activity by blocking binding to cognate cell-surface receptors^[3]. Human Noggin (hNoggin) has 205 amino acids (residues 28–232) after removal of its signal sequence (residues 1–27) and is secreted as a glycosylated, covalently linked homodimer. Human Noggin binds with high affinity to hBMP-4 (and with lower affinity to hBMP-7^[4].

1.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is ≤0.01 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1×10⁵units/mg.
2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is ≤0.06 μg/mL in the presence of 10 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1.7×10⁷units/mg.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is 0.0571 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is 1.751×10⁴ units/mg.

• 
  Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is 0.0868 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 1.152×10⁴ units/mg.

Mouse

CHO

Tag Free

P97466 (L20-C232)

18121  [NCBI]

LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 28-31 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS or 20 mM PB, 500 mM NaCl , pH 7.4, 5% trehalose, mannitol and 0.01% Tween 80.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Valenzuela DM, et al. Identification of mammalian noggin and its expression in the adult nervous system. J Neurosci. 1995 Sep;15(9):6077-84.  [Content Brief]

  [2]. Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280(5368):1455-7.  [Content Brief]

  [3]. Smith WC, et al. Secreted noggin protein mimics the Spemann organizer in dorsalizing Xenopus mesoderm. Nature. 1993 Feb 11;361(6412):547-9.  [Content Brief]

  [4]. Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420(6916):636-42.  [Content Brief]