1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Noggin Protein, Mouse (CHO)

Noggin Protein, Mouse (CHO) is a bone morphogenetic protein (BMP) antagonist.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Noggin Protein, Mouse (CHO) is a bone morphogenetic protein (BMP) antagonist.

Background

Mammalian noggin is remarkably similar in its sequence to Xenopus noggin, and is similarly active in induction assays performed on Xenopus embryo tissues. In the adult mammal, noggin is most notably expressed in the nervous system[1]. Noggin is a bone morphogenetic protein (BMP) antagonist expressed in Spemann's organizer. Murine Noggin is expressed in condensing cartilage and immature chondrocytes. In mice lacking Noggin, cartilage condensations initiated normally but developed hyperplasia, and initiation of joint development failed[2]. Noggin protein binds BMP4with high affinity and can abolish BMP4 activity by blocking binding to cognate cell-surface receptors[3]. Human Noggin (hNoggin) has 205 amino acids (residues 28–232) after removal of its signal sequence (residues 1–27) and is secreted as a glycosylated, covalently linked homodimer. Human Noggin binds with high affinity to hBMP-4 (and with lower affinity to hBMP-7[4].

Biological Activity

1.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is ≤0.01 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1×105units/mg.
2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is ≤0.06 μg/mL in the presence of 10 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1.7×107units/mg.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is ≤0.0571 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is ≥1.751×104 units/mg.

  • Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.0868 μg/mL in the presence of 30 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 1.152×104 units/mg.
Species

Mouse

Source

CHO

Tag

Tag Free

Accession

P97466 (L20-C232)

Gene ID
Molecular Construction
N-term
Noggin (L20-C232)
Accession # P97466
C-term
Synonyms
rMuNoggin; NOG
AA Sequence

LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Weight

Approximately 28-31 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS or 20 mM PB, 500 mM NaCl , pH 7.4, 5% trehalose, mannitol and 0.01% Tween 80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Noggin Protein, Mouse (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Noggin Protein, Mouse (CHO)
Cat. No.:
HY-P7086
Quantity:
MCE Japan Authorized Agent: