Noggin Protein, Human (HEK293)

Noggin Protein, Human (HEK293) is a recombinant protein produced by HEK293 cells. Noggin is a potent bone morphogenetic protein (BMP) antagonist capable of inhibiting vasculogenesis even in the presence of provasculogenic VEGF and FGF-2^[1].

Noggin is a glycosylated cysteine-knot chemokine protein, which functions as an extracellular negative regulator of transforming growth factor (TGF)β superfamily members. Alongside several other antagonists, Noggin blocks pluripotent bone morphogenetic protein (BMP) signaling that acts locally on target cells, affecting cell survival, proliferation, and differentiation. Noggin inhibits BMPs as a result of forming a neutralizing complex that prevents BMPs from binding to BMP receptor^[1].

1.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The IC₅₀ is < 1.97 ng/mL, corresponding to a specific activity of > 5.08×10⁵ units/ mg.
2.Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED₅₀ for this effect is <2 μg/mL in the presence of 2000 ng/mL of Recombinant Human BMP-2.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is ≤4.243 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is ≥2.357×10⁵ units/mg.
4.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is <3.0 ng/mL in the presence of 30 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is >3.33×10⁵ units/mg.

• 
  Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The IC₅₀ is 1.523 ng/mL, corresponding to a specific activity of 6.6×10⁵ units/ mg.

Human

HEK293

Tag Free

Q13253 (Q28-C232)

9241  [NCBI]

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Approximately 28-32 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 500 mM NaCl, 2 mM EDTA, pH 7.4 or PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009;23(12):4126-4134.  [Content Brief]