1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Noggin Protein, Human (HEK293)

Noggin Protein, Human (HEK293)

Cat. No.: HY-P70558
COA Handling Instructions

Noggin Protein, Human (HEK293) is a recombinant protein produced by HEK293 cells. Noggin is a potent bone morphogenetic protein (BMP) antagonist capable of inhibiting vasculogenesis even in the presence of provasculogenic VEGF and FGF-2.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg $120 In-stock
10 μg $200 In-stock
50 μg $600 In-stock
100 μg $1020 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Noggin Protein, Human (HEK293) is a recombinant protein produced by HEK293 cells. Noggin is a potent bone morphogenetic protein (BMP) antagonist capable of inhibiting vasculogenesis even in the presence of provasculogenic VEGF and FGF-2[1].

Background

Noggin is a glycosylated cysteine-knot chemokine protein, which functions as an extracellular negative regulator of transforming growth factor (TGF)β superfamily members. Alongside several other antagonists, Noggin blocks pluripotent bone morphogenetic protein (BMP) signaling that acts locally on target cells, affecting cell survival, proliferation, and differentiation. Noggin inhibits BMPs as a result of forming a neutralizing complex that prevents BMPs from binding to BMP receptor[1].

Biological Activity

1.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The IC50 is < 1.97 ng/mL, corresponding to a specific activity of > 5.08×105 units/ mg.
2.Measured by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED50 for this effect is <2 μg/mL in the presence of 2000 ng/mL of Recombinant Human BMP-2.
3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells The ED50 for this effect is <2 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.
4.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 3.0 ng/mL in the presence of 30 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 3.33×105 units/mg.

  • Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The IC50 is 1.523 ng/mL, corresponding to a specific activity of 6.6×105 units/ mg.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q13253 (Q28-C232)

Gene ID
Molecular Construction
N-term
Noggin (Q28-C232)
Accession # Q13253
C-term
Synonyms
Noggin; NOG
AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Weight

Approximately 28-32 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 500 mM NaCl, 2 mM EDTA, pH 7.4 or PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Noggin Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Noggin Protein, Human (HEK293)
Cat. No.:
HY-P70558
Quantity:
MCE Japan Authorized Agent: