Nucleophosmin/Npm1 Protein, Mouse (His-SUMO)

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Nucleophosmin/Npm1 is a multifunctional protein engaged in various cellular processes, including ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and the regulation of tumor suppressors such as p53/TP53 and ARF. Its involvement in driving ribosome nuclear export is associated with its binding to ribosomes, while it forms complexes with nucleolar ribonucleoprotein structures and binds single-stranded nucleic acids. Acting as a chaperonin for core histones H3, H2B, and H4, Npm1 stimulates APEX1 endonuclease activity on double-stranded DNA but inhibits it on single-stranded RNA. Additionally, it plays a role in controlling APEX1 endonuclease activity within nucleoli, contributing to the repair of apurinic/apyrimidinic sites on rDNA and the removal of oxidized rRNA molecules. Npm1 is implicated in centrosome and centriole duplication, negatively regulating EIF2AK2/PKR activation to suppress apoptosis. Furthermore, it interacts with various proteins, such as MYC, NSUN2, SENP3, and NEK2, highlighting its diverse molecular partnerships and functional versatility. The protein forms a decamer with disulfide-linked dimers under specific conditions and participates in complexes like the SWAP complex, emphasizing its dynamic engagement in cellular processes.

Mouse

E. coli

N-His;N-SUMO

Q61937 (M1-L292)

18148  [NCBI]

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Approximately 48.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.