1. Recombinant Proteins
  2. Others
  3. Nucleophosmin/Npm1 Protein, Mouse (His-SUMO)

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO)

Cat. No.: HY-P71574
SDS COA Handling Instructions

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $260 In-stock
20 μg $413 In-stock
50 μg $780 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The nucleophosmin/Npm1 protein is a multifunctional nucleolar phosphoprotein involved in multiple cellular processes, including ribosome assembly and transport, DNA repair, and centrosome duplication.It plays a crucial role in maintaining genome stability and regulating cell proliferation.Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nucleophosmin/Npm1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

Nucleophosmin/Npm1 is a multifunctional protein engaged in various cellular processes, including ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and the regulation of tumor suppressors such as p53/TP53 and ARF. Its involvement in driving ribosome nuclear export is associated with its binding to ribosomes, while it forms complexes with nucleolar ribonucleoprotein structures and binds single-stranded nucleic acids. Acting as a chaperonin for core histones H3, H2B, and H4, Npm1 stimulates APEX1 endonuclease activity on double-stranded DNA but inhibits it on single-stranded RNA. Additionally, it plays a role in controlling APEX1 endonuclease activity within nucleoli, contributing to the repair of apurinic/apyrimidinic sites on rDNA and the removal of oxidized rRNA molecules. Npm1 is implicated in centrosome and centriole duplication, negatively regulating EIF2AK2/PKR activation to suppress apoptosis. Furthermore, it interacts with various proteins, such as MYC, NSUN2, SENP3, and NEK2, highlighting its diverse molecular partnerships and functional versatility. The protein forms a decamer with disulfide-linked dimers under specific conditions and participates in complexes like the SWAP complex, emphasizing its dynamic engagement in cellular processes.

Species

Mouse

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q61937 (1M-292L)

Gene ID
Molecular Construction
N-term
6*His-SUMO
Npm1 (1M-292L)
Accession # Q61937
C-term
Synonyms
Npm1; Nucleophosmin; NPM; Nucleolar phosphoprotein B23; Nucleolar protein NO38; Numatrin
AA Sequence

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Molecular Weight

Approximately 48.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Nucleophosmin/Npm1 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Nucleophosmin/Npm1 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P71574
Quantity:
MCE Japan Authorized Agent: