1. Recombinant Proteins
  2. Others
  3. Osteomodulin Protein, Human (HEK293, His)

Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α(V)β(3)-integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag. The total length of Osteomodulin Protein, Human (HEK293, His) is 401 a.a., with molecular weight of 50-70 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α(V)β(3)-integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag. The total length of Osteomodulin Protein, Human (HEK293, His) is 401 a.a., with molecular weight of 50-70 KDa.

Background

Osteomodulin Protein emerges as a potential player in biomineralization processes, hinting at its involvement in the intricate mechanisms of mineral deposition. Notably, the protein demonstrates a functional role in binding osteoblasts through the alpha(V)beta(3)-integrin, suggesting a pivotal interaction in bone-related cellular activities. Additionally, Osteomodulin directly binds the alpha(V)beta(3)-integrin, further underscoring its significance in mediating interactions crucial for osteoblast function and potentially influencing processes related to bone formation and remodeling. Elucidating the specific molecular mechanisms and downstream effects of Osteomodulin's interactions with the alpha(V)beta(3)-integrin could provide valuable insights into its role in biomineralization and bone physiology.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q99983 (Q21-E421)

Gene ID
Molecular Construction
N-term
Osteomodulin (Q21-E421)
Accession # Q99983
His
C-term
Synonyms
Keratan sulfate proteoglycan osteomodulin; OSAD; OMD; SLRR2C
AA Sequence

QYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE

Molecular Weight

50-70 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Osteomodulin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Osteomodulin Protein, Human (HEK293, His)
Cat. No.:
HY-P76529
Quantity:
MCE Japan Authorized Agent: