Osteomodulin Protein, Human (HEK293, His)

Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α(V)β(3)-integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag. The total length of Osteomodulin Protein, Human (HEK293, His) is 401 a.a., with molecular weight of 50-70 KDa.

Osteomodulin Protein emerges as a potential player in biomineralization processes, hinting at its involvement in the intricate mechanisms of mineral deposition. Notably, the protein demonstrates a functional role in binding osteoblasts through the alpha(V)beta(3)-integrin, suggesting a pivotal interaction in bone-related cellular activities. Additionally, Osteomodulin directly binds the alpha(V)beta(3)-integrin, further underscoring its significance in mediating interactions crucial for osteoblast function and potentially influencing processes related to bone formation and remodeling. Elucidating the specific molecular mechanisms and downstream effects of Osteomodulin's interactions with the alpha(V)beta(3)-integrin could provide valuable insights into its role in biomineralization and bone physiology.

Human

HEK293

C-His

Q99983 (Q21-E421)

4958  [NCBI]

QYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE

50-70 kDa.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.