1. Recombinant Proteins
  2. Others
  3. PDCD4 Protein, Human (His)

PDCD4 Protein, Human (His)

Cat. No.: HY-P71191
COA Handling Instructions

PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $120 In-stock
50 μg $360 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.

Background

PDCD4, as a multifaceted protein, plays a pivotal role in inhibiting translation initiation and cap-dependent translation, potentially by disrupting the interaction between EIF4A1 and EIF4G and impeding the helicase activity of EIF4A. Moreover, it modulates JUN kinase activation and down-regulates MAP4K1 expression, thereby inhibiting crucial events associated with invasion and tumorigenesis. Functioning as a tumor suppressor, PDCD4 demonstrates the capacity to hinder neoplastic transformation induced by tumor promoters. It binds RNA and interacts with EIF4A1, EIF4A2, and EIF4G1, forming complexes that influence the translation machinery. Phosphorylation of PDCD4 facilitates interactions with BTRC and FBXW11, adding a layer of complexity to its regulatory functions in cellular processes, including apoptosis and tumor suppression.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q53EL6 (K212-P357)

Gene ID
Molecular Construction
N-term
PDCD4 (K212-P357)
Accession # Q53EL6
6*His
C-term
Synonyms
Programmed Cell Death Protein 4; Neoplastic Transformation Inhibitor Protein; Nuclear Antigen H731-Like; Protein 197/15a; PDCD4; H731
AA Sequence

KASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVP

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PDCD4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDCD4 Protein, Human (His)
Cat. No.:
HY-P71191
Quantity:
MCE Japan Authorized Agent: