PLAC9 Protein, Human (HEK293, Fc)

PLAC9 Protein, Human (HEK293, Fc) is the recombinant human-derived PLAC9 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of PLAC9 Protein, Human (HEK293, Fc) is 75 a.a., with molecular weight of ~37 kDa.

Human

HEK293

C-mFc

Q5JTB6 (A23-F97)

219348  [NCBI]

AEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

Approximately 34-38 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.