RGS17 Protein, Human (GST)

RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.

The RGS17 protein plays a pivotal role in the regulation of G protein-coupled receptor signaling cascades, including those mediated by muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Its regulatory function involves inhibiting signal transduction by enhancing the GTPase activity of G protein alpha subunits, thereby promoting their transition into the inactive GDP-bound form. RGS17 exhibits selective binding to GNAZ and GNAI2 subunits, accelerating their GTPase activity and modulating their signaling activities. Additionally, RGS17 negatively regulates mu-opioid receptor-mediated activation of G-proteins. The protein interacts with GNAI1 and GNAQ and forms complexes with mu-opioid receptors and Gαz/i2 subunits, contributing to mu-opioid receptor desensitization. Further molecular interactions include binding to OPRM1 and interacting with HINT1, underscoring the intricate regulatory network in which RGS17 participates to modulate diverse G protein-dependent signaling pathways.

Human

E. coli

N-GST

Q9UGC6 (M1-S210)

26575  [NCBI]

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

51.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.