1. Recombinant Proteins
  2. Others
  3. RGS17 Protein, Human (GST)

RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RGS17 protein centrally regulates G protein-coupled receptor signaling and inhibits signal transduction by enhancing the activity of G protein α subunit GTPase.It selectively binds to GNAZ and GNAI2 subunits, accelerates GTPase activity and regulates signaling.RGS17 Protein, Human (GST) is the recombinant human-derived RGS17 protein, expressed by E.coli , with N-GST labeled tag.

Background

The RGS17 protein plays a pivotal role in the regulation of G protein-coupled receptor signaling cascades, including those mediated by muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Its regulatory function involves inhibiting signal transduction by enhancing the GTPase activity of G protein alpha subunits, thereby promoting their transition into the inactive GDP-bound form. RGS17 exhibits selective binding to GNAZ and GNAI2 subunits, accelerating their GTPase activity and modulating their signaling activities. Additionally, RGS17 negatively regulates mu-opioid receptor-mediated activation of G-proteins. The protein interacts with GNAI1 and GNAQ and forms complexes with mu-opioid receptors and Gαz/i2 subunits, contributing to mu-opioid receptor desensitization. Further molecular interactions include binding to OPRM1 and interacting with HINT1, underscoring the intricate regulatory network in which RGS17 participates to modulate diverse G protein-dependent signaling pathways.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9UGC6 (M1-S210)

Gene ID
Molecular Construction
N-term
GST
RGS17 (M1-S210)
Accession # Q9UGC6
C-term
Synonyms
RGS17; RGSZ2; RGS-17; hRGS17; regulator of G-protein signaling 17; OTTHUMP00000017460
AA Sequence

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES

Molecular Weight

51.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RGS17 Protein, Human (GST) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RGS17 Protein, Human (GST)
Cat. No.:
HY-P700384
Quantity:
MCE Japan Authorized Agent: