ST3GAL3 Protein, Human (His-SUMO)

ST3GAL3 protein plays a central role in cellular processes by catalyzing the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- and NeuAc-α-2,3-Gal-beta-1,3-GalNAc- sequences are present in the terminal carbohydrate groups of glycoproteins and glycolipids. ST3GAL3 Protein, Human (His-SUMO) is the recombinant human-derived ST3GAL3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of ST3GAL3 Protein, Human (His-SUMO) is 347 a.a., with molecular weight of ~54.9 kDa.

ST3GAL3, or sialyltransferase 3, is an enzyme that catalyzes the formation of terminal carbohydrate sequences on glycoproteins and glycolipids. Specifically, it is responsible for adding sialic acid to the Gal-beta-1,3-GlcNAc, Gal-beta-1,3-GlcNAc, and Gal-beta-1,3-GalNAc structures, resulting in the formation of NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc, and NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc sequences. These sialylation events play a crucial role in modulating the structure and function of glycoproteins and glycolipids, impacting various cellular processes. ST3GAL3 exhibits varying degrees of activity towards different substrates, with the highest activity observed towards Gal-beta-1,3-GlcNAc and the lowest towards Gal-beta-1,3-GalNAc. It has to succinctly outline ST3GAL3's role in catalyzing the addition of sialic acid to specific carbohydrate structures, highlighting its contribution to the diversity of terminal glycan sequences in biological molecules.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-His;N-SUMO

Q11203 (29K-375I)

6487  [NCBI]

KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Approximately 54.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.