Syntenin-1 Protein, Human (N-His)

Syntenin-1 protein is known to mediate Syndecan signaling and has a PDZ domain that binds transmembrane proteins. It affects cytoskeletal membrane organization, cell adhesion, protein trafficking, and transcription factor activation. Syntenin-1 Protein, Human (N-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Syntenin-1 Protein, Human (N-His) is 298 a.a., with molecular weight of ~32 kDa.

Syntenin-1 Protein, initially recognized as a mediator linking syndecan-mediated signaling to the cytoskeleton, is characterized by tandemly repeated PDZ domains capable of binding the cytoplasmic, C-terminal domains of various transmembrane proteins. Beyond its role in syndecan signaling, syntenin-1 is implicated in influencing cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. While primarily localized to membrane-associated adherens junctions and focal adhesions, this protein is also present in the endoplasmic reticulum and nucleus. Alternative splicing generates multiple transcript variants encoding diverse isoforms. Furthermore, related pseudogenes have been identified on multiple chromosomes. With ubiquitous expression observed in placenta (RPKM 77.0), gall bladder (RPKM 73.7), and 25 other tissues, syntenin-1's wide-ranging presence underscores its involvement in diverse cellular processes across various tissues.

Human

E. coli

N-6*His

NP_001007068.1 (M1-V298)

6386  [NCBI]

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV

Approximately 32 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.