1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. TIGIT Protein
  5. TIGIT Protein, Mouse (118a.a, HEK293, Fc)

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (118a.a, HEK293, Fc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Mouse (118a.a, HEK293, Fc) is 118 a.a., with molecular weight of 50-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIGIT protein, with signaling receptor binding activity, functions upstream of T cell activation suppression. Active on the cell surface, it shares orthology with human TIGIT. Associated with modulating T cell responses, TIGIT exhibits biased expression, notably in the large intestine, small intestine, and other tissues. This highlights its potential in immune regulation within these contexts. TIGIT Protein, Mouse (118a.a, HEK293, Fc) is the recombinant mouse-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Mouse (118a.a, HEK293, Fc) is 118 a.a., with molecular weight of 50-60 kDa.

Background

TIGIT protein, characterized by its signaling receptor binding activity, operates upstream of negative regulation of T cell activation. Predicted to be active on the cell surface, this protein, orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains), is associated with the modulation of T cell responses. The expression of TIGIT is biased, with notable levels observed in the large intestine, small intestine, and several other tissues, emphasizing its potential role in immune regulation within these contexts.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

NP_001139797 (G26-T143)

Gene ID
Molecular Construction
N-term
TIGIT (G26-T143)
Accession # NP_001139797
hFc
C-term
Synonyms
T-cell immunoreceptor with Ig and ITIM domains; Tigit
AA Sequence

GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLGGT

Molecular Weight

50-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TIGIT Protein, Mouse (118a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Mouse (118a.a, HEK293, Fc)
Cat. No.:
HY-P71009
Quantity:
MCE Japan Authorized Agent: