1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins
  4. Tetraspanin 7/CD231
  5. TM4SF2/TSPAN7 Protein, Human (HEK293, His)

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Background

Tetraspanin-7 (TSPAN7) is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Notably, this encoded cell surface glycoprotein has been demonstrated to exert a vital role in the control of neurite outgrowth. Overexpression of TSPAN7 activates Bax, cleaves caspase-3 and PTEN, and inhibits BCa cell growth through the PTEN/PI3K/AKT pathway. Low expression of TSPAN7 is associated with response to oxidative stress, regulation of MAPK, cell population of proliferation, response to tumor necrosis factor, regulation of cell migration, negative regulation of programmed cell death and angiogenesis. In addition, TSPAN7 plays an important role in the cytoskeletal organization required for the bone-resorbing function of osteoclasts by regulating signaling to Src, Pyk2, and microtubules[1][2].

Biological Activity

When Recombinant Human TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Rabbit Anti-TSPAN7 Antibody. The ED50 for this effect is 111.6 ng/mL.

  • When Recombinant Human TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Rabbit Anti-TSPAN7 Antibody. The ED50 for this effect is 111.6 ng/mL.
Species

Human

Source

HEK293

Tag

C-His

Accession

AAH18036.1 (R113-M213)

Gene ID
Molecular Construction
N-term
TM4SF2 (R113-M213)
Accession # AAH18036.1
His
C-term
Synonyms
Tetraspanin-7; Tspan-7; CD231; Mxs1; Tm4sf2
AA Sequence

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Weight

Approximately 21-30 kDa due to glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TM4SF2/TSPAN7 Protein, Human (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TM4SF2/TSPAN7 Protein, Human (HEK293, His)
Cat. No.:
HY-P77497
Quantity:
MCE Japan Authorized Agent: