TM4SF2/TSPAN7 Protein, Human (HEK293, His)

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag. The total length of TM4SF2/TSPAN7 Protein, Human (HEK293, His) is 101 a.a., with molecular weight of 24-30 kDa.

Tetraspanin-7 (TSPAN7) is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. Notably, this encoded cell surface glycoprotein has been demonstrated to exert a vital role in the control of neurite outgrowth. Overexpression of TSPAN7 activates Bax, cleaves caspase-3 and PTEN, and inhibits BCa cell growth through the PTEN/PI3K/AKT pathway. Low expression of TSPAN7 is associated with response to oxidative stress, regulation of MAPK, cell population of proliferation, response to tumor necrosis factor, regulation of cell migration, negative regulation of programmed cell death and angiogenesis. In addition, TSPAN7 plays an important role in the cytoskeletal organization required for the bone-resorbing function of osteoclasts by regulating signaling to Src, Pyk2, and microtubules^[1][2].

When Recombinant Human TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Rabbit Anti-TSPAN7 Antibody. The ED₅₀ for this effect is 111.6 ng/mL.

• 
  When Recombinant Human TSPAN7 Protein is immobilized at 2 µg/mL (100 µL/well) can bind Rabbit Anti-TSPAN7 Antibody. The ED₅₀ for this effect is 111.6 ng/mL.

Human

HEK293

C-His

AAH18036.1 (R113-M213)

7102  [NCBI]

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Approximately 21-30 kDa due to glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.