TMIGD2 Protein, Human (HEK293, His)

TMIGD2 is a multifaceted protein actively involved in cellular processes, including cell-cell interactions, migration, and angiogenesis. Its interaction with HHLA2 enhances T cell proliferation and cytokine production through AKT-dependent signaling during TCR-mediated activation. TMIGD2 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD2 protein, expressed by HEK293 , with C-6*His labeled tag.

TMIGD2, a multifaceted protein, actively participates in various cellular processes such as cell-cell interaction, cell migration, and angiogenesis. Its interaction with HHLA2 highlights its role in costimulating T-cells during TCR-mediated activation, thereby enhancing T-cell proliferation and cytokine production through an AKT-dependent signaling cascade. TMIGD2 may also engage in homophilic interactions, potentially regulating cell-cell communication. Additionally, it forms interactions with CACNB2, DST, MIA, and NCKIPSD, indicating its involvement in diverse cellular pathways and signaling networks. These interactions collectively underscore the versatile functions of TMIGD2 in orchestrating essential cellular activities.

Human

HEK293

C-6*His

Q96BF3-1 (L23-G150)

126259  [NCBI]

LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.