VEGF120 Protein, Mouse

VEGF-A Protein is a key member of the VEGF family of cytokines.VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability.VEGF-A stimulates endothelial cell mitogenesis and cell migration.VEGF120 Protein, Mouse is the recombinant mouse-derived VEGF120 protein, expressed by E.coli , with tag free.

VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1, KDR/VEGFR2 and DEAR/FBXW7-AS1 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability^{[1][2][3][4][5]}.

The cell proliferation assay using human umbilical vein endothelial cells has an ED50 value of less than 5 ng/ml; corresponding to a specific activity of > 2.0 × 10⁵ IU/mg.

Mouse

E. coli

Tag Free

Q00731-3 (A27-R146)

22339  [NCBI]

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

Approximately 28.4 kDa (Disulfide-linked homodimer)

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.