WBP2 Protein, Human (His)

WBP2 protein is not mentioned in the provided paragraph. If you have another paragraph or topic you'd like summarized with WBP2 as the subject, please provide it, and I'll be happy to assist. WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

NLRP1 protein acts as the sensor component of the NLRP1 inflammasome, a crucial mediator of inflammasome activation in response to various pathogen-associated signals, leading to subsequent pyroptosis. As a recognition receptor, NLRP1 identifies specific pathogens and damage-associated signals, initiating the formation of the inflammasome polymeric complex composed of NLRP1, CASP1, and PYCARD/ASC. Upon pathogen-associated signals, the N-terminal part of NLRP1 is degraded, releasing the cleaved C-terminal part, which polymerizes and associates with PYCARD/ASC. This complex recruits pro-caspase-1, promoting caspase-1 activation and subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to pyroptosis. In the absence of GSDMD, the NLRP1 inflammasome recruits and activates CASP8, leading to gasdermin-E (GSDME) activation. NLRP1 activation is also required for HMGB1 secretion, stimulating inflammatory responses. Recognizing pathogen-associated signals like human rhinoviruses, positive-strand RNA viruses, and muramyl dipeptide, NLRP1 plays a pivotal role in antiviral immunity and inflammation. Additionally, UV-B irradiation induces ribosome collisions, activating NLRP1 through MAP3K20-dependent phosphorylation and leading to pyroptosis. NLRP1 constitutes the precursor of the NLRP1 inflammasome, undergoing autoproteolytic processing within the FIIND domain in response to pathogens and damage-associated signals.

Human

E. coli

N-6*His

Q969T9-1 (M1-A100)

23558  [NCBI]

MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.