1. Recombinant Proteins
  2. Others
  3. WBP2 Protein, Human (His)

WBP2 protein is not mentioned in the provided paragraph. If you have another paragraph or topic you'd like summarized with WBP2 as the subject, please provide it, and I'll be happy to assist. WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

WBP2 protein is not mentioned in the provided paragraph. If you have another paragraph or topic you'd like summarized with WBP2 as the subject, please provide it, and I'll be happy to assist. WBP2 Protein, Human (His) is the recombinant human-derived WBP2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

NLRP1 protein acts as the sensor component of the NLRP1 inflammasome, a crucial mediator of inflammasome activation in response to various pathogen-associated signals, leading to subsequent pyroptosis. As a recognition receptor, NLRP1 identifies specific pathogens and damage-associated signals, initiating the formation of the inflammasome polymeric complex composed of NLRP1, CASP1, and PYCARD/ASC. Upon pathogen-associated signals, the N-terminal part of NLRP1 is degraded, releasing the cleaved C-terminal part, which polymerizes and associates with PYCARD/ASC. This complex recruits pro-caspase-1, promoting caspase-1 activation and subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to pyroptosis. In the absence of GSDMD, the NLRP1 inflammasome recruits and activates CASP8, leading to gasdermin-E (GSDME) activation. NLRP1 activation is also required for HMGB1 secretion, stimulating inflammatory responses. Recognizing pathogen-associated signals like human rhinoviruses, positive-strand RNA viruses, and muramyl dipeptide, NLRP1 plays a pivotal role in antiviral immunity and inflammation. Additionally, UV-B irradiation induces ribosome collisions, activating NLRP1 through MAP3K20-dependent phosphorylation and leading to pyroptosis. NLRP1 constitutes the precursor of the NLRP1 inflammasome, undergoing autoproteolytic processing within the FIIND domain in response to pathogens and damage-associated signals.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q969T9-1 (M1-A100)

Gene ID
Molecular Construction
N-term
6*His
WBP2 (M1-A100)
Accession # Q969T9-1
C-term
Synonyms
WW Domain-Binding Protein 2; WBP-2; WBP2
AA Sequence

MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

WBP2 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
WBP2 Protein, Human (His)
Cat. No.:
HY-P71431
Quantity:
MCE Japan Authorized Agent: