Search Result

Search Result

Results for "

RANTES

" in MedChemExpress (MCE) Product Catalog:

By Targets:	CCR (4) HIV (1) Interleukin Related (1) PI3K (1)
By Research Areas:	Endocrinology (1) Infection (2) Inflammation/Immunology (4)

6

Inhibitors & Agonists

1

Peptides

1

Inhibitory Antibodies

8

Recombinant Proteins

1

Antibodies

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

AS-041164	PI3K	Inflammation/Immunology
AS-041164 is a potent, selective and orally active PI3Kγ isoform inhibitor with an IC₅₀ of 70 nM. AS-041164 shows less activity against PI3Kα, PI3Kβ, and PI3Kδ (IC₅₀s of 240 nM, 1.45 μM, and 1.70 μM, respectively). AS-041164 has anti-inflammatory effects .

Anrukinzumab IMA-638	Interleukin Related	Inflammation/Immunology
Anrukinzumab (IMA-638) is a humanized anti-IL-13 monoclonal antibody. Anrukinzumab effectively reduces lung inflammation in a cynomolgus monkey model. Anrukinzumab can be used in studies of ulcerative colitis (UC) as well as asthma .

TAK-220 2 Publications Verification	CCR HIV	Infection Endocrinology
TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC₅₀s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC₅₀s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC₉₀s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.

*Met-RANTES* (human)** MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

RP23618	CCR	Infection Inflammation/Immunology
RP23618 is a non peptidic *RANTES* antagonist with the IC₅₀ of 3 μM. RP23618 inhibit RANTES-induced chemotaxis of THP-1 cells .

YM-344031	CCR	Inflammation/Immunology
YM-344031 is an orally active antagonist for CCR3. YM-344031 inhibits binding of Eotaxin-1 and RANTES to CCR3, with IC₅₀ of 3.0 and 16.3 nM. YM-344031 inhibits ligand-induced rise in intracellular Ca ^[2+] and the ligand-induced chemotaxis. YM-344031 inhibits eotaxin-1-induced changes in eosinophil morphology in macaques blood, and prevents allergic skin reactions in a mouse allergy model .

Cat. No.	Product Name	Target	Research Area

*Met-RANTES* (human)** MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

Cat. No.	Product Name	Target	Research Area

Anrukinzumab IMA-638	Interleukin Related	Inflammation/Immunology
Anrukinzumab (IMA-638) is a humanized anti-IL-13 monoclonal antibody. Anrukinzumab effectively reduces lung inflammation in a cynomolgus monkey model. Anrukinzumab can be used in studies of ulcerative colitis (UC) as well as asthma .

Species:	Human (4) Rat (2) Mouse (2)
Tag:	His (4) SUMO (1) Tag Free (3) Avi (1) Fc (1)
Source:	HEK293 (2) P. pastoris (1) E. coli (5)

Cat. No.	Compare	Product Name	Species	Source

	RANTES/CCL5 Protein, Human (HEK293) rHuRANTES/CCL5; C-C motif chemokine 5; SCYA5	Human	HEK293
	RANTES/CCL5 Protein, Human (HEK293) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human ( HEK293) is a recombinant human RANTES/CCL5(S24-S91) protein expressed by HEK293.

	RANTES/CCL5 Protein, Rat (P.pastoris, His) C-C motif chemokine 5; SIS-delta; T-cell-specific protein RANTES; Ccl5; Scya5	Rat	P. pastoris
	RANTES/CCL5 Protein, Rat (P.pastoris, His) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Rat (P.pastoris, His) is a recombinant rat RANTES/CCL5 (S25-S92) protein expressed by P.pastoris with a His tag at the C-terminu.

	RANTES/CCL5 Protein, Mouse Ccl5; Scya5C-C motif chemokine 5; MuRANTES; SIS-delta; Small-inducible cytokine A5; T-cell-specific protein RANTES	Mouse	E. coli
	RANTES/CCL5 Protein, Mouse is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Mouse is a recombinant mouse CCL5(S24-S91) protein expressed by E. coli.

	RANTES/CCL5 Protein, Mouse (HEK293, Fc) MuRANTES; SIS-delta; Scya5; Ccl5; D17S136E; eoCP; RANTES; SCYA5; SISd; TCP228; CCL5	Mouse	HEK293
	RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis.RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANTES/CCL5 (S24-S91) protein expressed by HEK293 with a hFc tag at the N-terminu.

	RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) MuRANTES; SIS-delta; Scya5; Ccl5; D17S136E; eoCP; RANTES; SCYA5; SISd; TCP228; CCL5	Human	E. coli
	RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with C-Avi, N-His labeled tag. The total length of RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is 68 a.a., with molecular weight of 10.89 kDa.

	RANTES/CCL5 Protein, Rat (His) rRtCCL5, His; C-C motif chemokine 5; SIS-delta; Small-inducible cytokine A5; T-cell-specific protein RANTES; Ccl5; Scya5	Rat	E. coli
	RANTES/CCL5 Protein, Rat (His) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Rat (His) is a recombinant rat RANTES/CCL5 (S25-S92) protein expressed by E. coli with a His tag at the C-terminu.

	RANTES/CCL5 Protein, Human 2 Publications Verification C-C Motif Chemokine 5; EoCP; Eosinophil Chemotactic Cytokine; SIS-Delta; Small-Inducible Cytokine A5; T Cell-Specific Protein P228; TCP228; T-Cell-Specific Protein RANTES; CCL5; D17S136E; SCYA5	Human	E. coli
	RANTES/CCL5 Protein is a secreted protein located outside the cell membrane and is a key pro-inflammatory chemokine and immune regulatory molecule in the CC chemokine family. RANTES/CCL5 Protein sends signals through its specific G protein-coupled receptors (GPCR) CCR1, CCR3, and CCR5, mediating inflammatory immune responses, viral infections, and tumor development. RANTES/CCL5 Protein can promote endothelial cell migration, proliferation, and angiogenesis in rats. RANTES/CCL5 Protein is useful for research into tumors, autoimmune diseases, and atherosclerosis. RANTES/CCL5 Protein, Human is a recombinant human CCL5 (S24-S91) protein expressed by E. coli.

	RANTES/CCL5 Protein, Human (His-SUMO) MuRANTES; SIS-delta; Scya5; Ccl5; D17S136E; eoCP; RANTES; SCYA5; SISd; TCP228; CCL5	Human	E. coli
	RANTES/CCL5 Protein, Human (His-SUMO) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human (His-SUMO) is a recombinant human RANTES/CCL5 (S24-S91) protein expressed by E. coli with a His and a SUMO tag at the N-terminu.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Compare	Product Name	Application	Reactivity

	RANTES Antibody (YA2383) SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta	WB, ICC/IF	Human
	RANTES Antibody (YA2383) is a rabbit-derived non-conjugated IgG antibody (Clone NO.: YA2383), targeting RANTES, with a predicted molecular weight of 10 kDa (observed band size: 10 kDa). RANTES Antibody (YA2383) can be used for WB, ICC/IF experiment in human background.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

MedChemExpress Magic Cece

MedChemExpress: Contact Us; About Us; Headquarters; Distributors; Statement on False Report; Careers

Customer Support: Technical Support; Service; Ordering Information; Easy Return; Shipping Rates & Policies; Intellectual Property Promise

Resources: Free Sample; Resources; Molarity Calculator; Dilution Calculator; Terms & Conditions; Reconstitution Calculator; Specific Activity Calculator

Subscribe to our E-newsletter

Name
Email *

	Sorry, but the email address you supplied was invalid.

Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.

Copyright © 2013-2024 MedChemExpress. All Rights Reserved.: Site Map Privacy Policy

Join with us