RANTES

By Targets:	CCR (7) Fungal (1) HIV (3) Interleukin Related (1) PI3K (1)
By Research Areas:	Cancer (3) Endocrinology (1) Infection (5) Inflammation/Immunology (8)

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P4191A

*Met-RANTES* (human) (acetate)**	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-118521

AS-041164	PI3K	Inflammation/Immunology
AS-041164 is a potent, selective and orally active PI3Kγ isoform inhibitor with an IC₅₀ of 70 nM. AS-041164 shows less activity against PI3Kα, PI3Kβ, and PI3Kδ (IC₅₀s of 240 nM, 1.45 μM, and 1.70 μM, respectively). AS-041164 has anti-inflammatory effects .

HY-P99439

Anrukinzumab IMA-638	Interleukin Related	Inflammation/Immunology
Anrukinzumab (IMA-638) is a humanized anti-IL-13 monoclonal antibody. Anrukinzumab effectively reduces lung inflammation in a cynomolgus monkey model. Anrukinzumab can be used in studies of ulcerative colitis (UC) as well as asthma .

HY-33037

Phenazine-1-carboxylic acid	Fungal	Infection Inflammation/Immunology Cancer
Phenazine-1-carboxylic acid is an antifungal agent. Additionally, Phenazine-1-carboxylic acid exhibits anticancer activity by inducing apoptosis in cancer cells through the regulation of ROS generation. Phenazine-1-carboxylic acid can upregulate the expression of IL-8 and ICAM-1 while inhibiting the release of RANTES and MCP-1, demonstrating its potential immunomodulatory effects. Phenazine-1-carboxylic acid holds significant research value in the areas of anti-infection, anticancer, and immune response modulation .

HY-19974

TAK-220 2 Publications Verification	CCR HIV	Infection Endocrinology
TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC₅₀s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC₅₀s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC₉₀s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.

HY-P4191

*Met-RANTES* (human)** MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-123270

RP23618	CCR	Infection Inflammation/Immunology
RP23618 is a non peptidic *RANTES* antagonist with the IC₅₀ of 3 μM. RP23618 inhibit RANTES-induced chemotaxis of THP-1 cells .

HY-B0155

Vicriviroc SCH 417690; SCH-D; MK-7690 free base	CCR HIV	Infection Cancer
Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC₅₀ of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC₅₀ values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .

HY-B0155B

Vicriviroc malate SCH 417690 malate; SCH-D malate; MK-7690	CCR HIV	Infection Cancer
Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC₅₀ of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC₅₀ values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .

HY-160998

YM-344031	CCR	Inflammation/Immunology
YM-344031 is an orally active antagonist for CCR3. YM-344031 inhibits binding of Eotaxin-1 and RANTES to CCR3, with IC₅₀ of 3.0 and 16.3 nM. YM-344031 inhibits ligand-induced rise in intracellular Ca ^[2+] and the ligand-induced chemotaxis. YM-344031 inhibits eotaxin-1-induced changes in eosinophil morphology in macaques blood, and prevents allergic skin reactions in a mouse allergy model .

Cat. No.	Product Name	Target	Research Area

HY-P4191A

*Met-RANTES* (human) (acetate)**	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P4191

*Met-RANTES* (human)** MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

Cat. No.	Product Name	Target	Research Area

HY-P99439

Anrukinzumab IMA-638	Interleukin Related	Inflammation/Immunology
Anrukinzumab (IMA-638) is a humanized anti-IL-13 monoclonal antibody. Anrukinzumab effectively reduces lung inflammation in a cynomolgus monkey model. Anrukinzumab can be used in studies of ulcerative colitis (UC) as well as asthma .

HY-P990677

VLST-002	Inhibitory Antibodies	Inflammation/Immunology
VLST-002 is a humanized antibody expressed in CHO cells, targeting *CCL5/RANTES*. VLST-002 has a huIgG1 heavy chain and a huκ light chain, with a predicted molecular weight (MW) of 150 kDa. The isotype control for VLST-002 can refer to Human IgG1 kappa, Isotype Control (HY-P99001).

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-33037

Phenazine-1-carboxylic acid	Infection Alkaloids Structural Classification Microorganisms Classification of Application Fields Other Alkaloids Marine natural products Source classification Disease Research Fields	Fungal
Phenazine-1-carboxylic acid is an antifungal agent. Additionally, Phenazine-1-carboxylic acid exhibits anticancer activity by inducing apoptosis in cancer cells through the regulation of ROS generation. Phenazine-1-carboxylic acid can upregulate the expression of IL-8 and ICAM-1 while inhibiting the release of RANTES and MCP-1, demonstrating its potential immunomodulatory effects. Phenazine-1-carboxylic acid holds significant research value in the areas of anti-infection, anticancer, and immune response modulation .

Species:	Human (4) Rat (2) Mouse (2)
Tag:	His (4) SUMO (1) Tag Free (3) Avi (1) Fc (1)
Source:	HEK293 (2) P. pastoris (1) E. coli (5)

Cat. No.	Compare	Product Name	Species	Source

HY-P7282

	RANTES/CCL5 Protein, Human (HEK293) rHuRANTES/CCL5; C-C motif chemokine 5; SCYA5	Human	HEK293
	RANTES/CCL5 Protein, Human (HEK293) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human ( HEK293) is a recombinant human RANTES/CCL5(S24-S91) protein expressed by HEK293.

HY-P74602

	RANTES/CCL5 Protein, Rat (P.pastoris, His) C-C motif chemokine 5; SIS-delta; T-cell-specific protein RANTES; Ccl5; Scya5	Rat	P. pastoris
	RANTES/CCL5 Protein, Rat (P.pastoris, His) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Rat (P.pastoris, His) is a recombinant rat RANTES/CCL5 (S25-S92) protein expressed by P.pastoris with a His tag at the C-terminu.

HY-P71890

	RANTES/CCL5 Protein, Mouse Ccl5; Scya5C-C motif chemokine 5; MuRANTES; SIS-delta; Small-inducible cytokine A5; T-cell-specific protein RANTES	Mouse	E. coli
	RANTES/CCL5 Protein, Mouse is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Mouse is a recombinant mouse CCL5(S24-S91) protein expressed by E. coli.

HY-P78249

	RANTES/CCL5 Protein, Mouse (HEK293, Fc) MuRANTES; SIS-delta; Scya5; Ccl5; D17S136E; eoCP; RANTES; SCYA5; SISd; TCP228; CCL5	Mouse	HEK293
	RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis.RANTES/CCL5 Protein, Mouse (HEK293, Fc) is a recombinant mouse RANTES/CCL5 (S24-S91) protein expressed by HEK293 with a hFc tag at the N-terminu.

HY-P700861

	RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) MuRANTES; SIS-delta; Scya5; Ccl5; D17S136E; eoCP; RANTES; SCYA5; SISd; TCP228; CCL5	Human	E. coli
	RANTES/CCL5 protein attracts monocytes, memory T-helper cells, and eosinophils, releases histamine, and activates eosinophils. It interacts with chemokine receptors CCR1, CCR3, CCR4, and CCR5. It inhibits HIV and may promote neuron survival and insulin secretion via GPR75. RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived RANTES/CCL5 protein, expressed by E. coli , with C-Avi, N-His labeled tag. The total length of RANTES/CCL5 Protein, Human (Biotinylated, His-Avi) is 68 a.a., with molecular weight of 10.89 kDa.

HY-P7761

	RANTES/CCL5 Protein, Rat (His) rRtCCL5, His; C-C motif chemokine 5; SIS-delta; Small-inducible cytokine A5; T-cell-specific protein RANTES; Ccl5; Scya5	Rat	E. coli
	RANTES/CCL5 Protein, Rat (His) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Rat (His) is a recombinant rat RANTES/CCL5 (S25-S92) protein expressed by E. coli with a His tag at the C-terminu.

HY-P70450

	RANTES/CCL5 Protein, Human 2 Publications Verification C-C Motif Chemokine 5; EoCP; Eosinophil Chemotactic Cytokine; SIS-Delta; Small-Inducible Cytokine A5; T Cell-Specific Protein P228; TCP228; T-Cell-Specific Protein RANTES; CCL5; D17S136E; SCYA5	Human	E. coli
	RANTES/CCL5 Protein is a secreted protein located outside the cell membrane and is a key pro-inflammatory chemokine and immune regulatory molecule in the CC chemokine family. RANTES/CCL5 Protein sends signals through its specific G protein-coupled receptors (GPCR) CCR1, CCR3, and CCR5, mediating inflammatory immune responses, viral infections, and tumor development. RANTES/CCL5 Protein can promote endothelial cell migration, proliferation, and angiogenesis in rats. RANTES/CCL5 Protein is useful for research into tumors, autoimmune diseases, and atherosclerosis. RANTES/CCL5 Protein, Human is a recombinant human CCL5 (S24-S91) protein expressed by E. coli.

HY-P78399

	RANTES/CCL5 Protein, Human (His-SUMO) MuRANTES; SIS-delta; Scya5; Ccl5; D17S136E; eoCP; RANTES; SCYA5; SISd; TCP228; CCL5	Human	E. coli
	RANTES/CCL5 Protein, Human (His-SUMO) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human (His-SUMO) is a recombinant human RANTES/CCL5 (S24-S91) protein expressed by E. coli with a His and a SUMO tag at the N-terminu.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P82638

	RANTES Antibody (YA2383) SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta	WB, ICC/IF	Human
	RANTES Antibody (YA2383) is a rabbit-derived non-conjugated IgG antibody (Clone NO.: YA2383), targeting RANTES, with a predicted molecular weight of 10 kDa (observed band size: 10 kDa). RANTES Antibody (YA2383) can be used for WB, ICC/IF experiment in human background.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Antibodies

Name
Email *

	Sorry, but the email address you supplied was invalid.

RANTES

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

NaturalProducts

Recombinant Proteins

Antibodies

Natural
Products