1. Peptides
  2. Peptide and Derivatives
  3. Peptides for Drug Delivery
  4. Cell-penetrating Peptides
  5. Tat-peptide control 168-189

Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Tat-peptide control 168-189 Chemical Structure

Tat-peptide control 168-189 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of Tat-peptide control 168-189:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron[1].

In Vitro

Tat-peptide 190-208 (10 μM, 20 μM; 24 h) increases axon length in dissociated DRG cultures with 10 μM, as well as in iMotor neurons with 20 μM[1].
Tat-peptide 190-208 (10 μM; 3 d) increases the overall number of neurites extended from each neuron[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3916.97

Formula

C162H239N47O65S

Sequence

Asp-Asp-Ser-Gly-Thr-Phe-Tyr-Asp-Gln-Ala-Val-Val-Ser-Asn-Asp-Met-Glu-Glu-His-Leu-Glu-Glu-Pro-Tyr-Gly-Asn-Lys-Lys-Asn-Asn-Gln-Asn-Asn-Asn

Sequence Shortening

DDSGTFYDQAVVSNDMEEHLEEPYGNKKNNQNNN

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tat-peptide control 168-189
Cat. No.:
HY-P5119
Quantity:
MCE Japan Authorized Agent: