Neuropeptide Y (human,rat,mouse) (TFA)

Name: Neuropeptide Y (human,rat,mouse) (TFA)
Brand: MedChemExpress
SKU: HY-P0198A
Rating: 4.5 (1 reviews)

Cat. No.: HY-P0198A Purity: 98.60%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

Neuropeptide Y (human) TFA is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Neuropeptide Y (human,rat,mouse) (TFA) Chemical Structure

Size	Price	Stock	Quantity
1 mg	USD 180	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 720	In-stock	Estimated Time of Arrival: December 31
10 mg		Get quote
50 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Neuropeptide Y (human,rat,mouse) (TFA):

[D-Arg25]-Neuropeptide Y (human) Get quote
Neuropeptide Y (human,rat,mouse) Get quote

1 Publications Citing Use of MCE Neuropeptide Y (human,rat,mouse) (TFA)

•Adv Sci (Weinh). 2024 Jul 8:e2400196. [Abstract]

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

View All Neuropeptide Y Receptor Isoform Specific Products:

View All Isoforms

NPY Y₁ receptor NPY Y₂ receptor NPY Y₄ receptor NPY Y₅ receptor

Biological Activity
Protocol
Purity & Documentation
References
Customer Review

Description

Neuropeptide Y (human) TFA is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

In Vitro

It is showed that Neuropeptide Y (human) is able to protect cortical neurons from Aβ_25-35 toxicity. 2 μM NPY abolishes the toxic effects of Aβ_25-35 at 24 and 48 h. The same effect on neuronal survival is observed in neurons exposed to 1 μM and 0.5 μM Neuropeptide Y (human) pretreatments. Pretreatment with Neuropeptide Y (29-64), amide, human (TFA) Increases NGF Synthesis, reduces NGF mRNA, and restores NGF release in cortical neurons exposed to Aβ_35-25^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4385.70

Formula

C₁₉₁H₂₈₆F₃N₅₅O₅₉S

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Sequence Shortening

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility

In Vitro:

H₂O : 100 mg/mL (22.80 mM; Need ultrasonic)

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2280 mL	1.1401 mL	2.2801 mL
5 mM	0.0456 mL	0.2280 mL	0.4560 mL
10 mM	0.0228 mL	0.1140 mL	0.2280 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)

Volume _(start)

Concentration _(final)

Volume _(final)

In Vivo:

For the following dissolution methods, please prepare the working solution directly. It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

Protocol 1

Add each solvent one by one: PBS
Solubility: 100 mg/mL (22.80 mM); Clear solution; Need ultrasonic

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 98.60%

Select Batch:

Data Sheet (270 KB) SDS (252 KB)

COA (240 KB) RP-HPLC (112 KB) MS (223 KB) Elemental Analysis Report (100 KB)

Handling Instructions (2659 KB)

References

[1]. Croce N, et al. Neuropeptide Y protects rat cortical neurons against β-amyloid toxicity and re-establishes synthesis and release of nerve growth factor. ACS Chem Neurosci. 2012 Apr 18;3(4):312-8. [Content Brief]

Cell Assay ^[1]	Primary cortical neurons are preincubated either alone (positive control) or with three concentrations of Neuropeptide Y (human) (NPY) (0.5, 1, and 2 μM) for 24 h and then exposed to Aβ_25-35 (50 μM) or Aβ_35-25 (50 μM) for 48 h^[1]. MCE has not independently confirmed the accuracy of these methods. They are for reference only.
References	[1]. Croce N, et al. Neuropeptide Y protects rat cortical neurons against β-amyloid toxicity and re-establishes synthesis and release of nerve growth factor. ACS Chem Neurosci. 2012 Apr 18;3(4):312-8. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O	1 mM	0.2280 mL	1.1401 mL	2.2801 mL	5.7003 mL
	5 mM	0.0456 mL	0.2280 mL	0.4560 mL	1.1401 mL
	10 mM	0.0228 mL	0.1140 mL	0.2280 mL	0.5700 mL
	15 mM	0.0152 mL	0.0760 mL	0.1520 mL	0.3800 mL
	20 mM	0.0114 mL	0.0570 mL	0.1140 mL	0.2850 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.