1. GPCR/G Protein
  2. GCGR
  3. Beinaglutide

Beinaglutide  (Synonyms: GLP-1 (human))

Cat. No.: HY-P3463 Purity: 99.74%
COA Handling Instructions

Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH).

For research use only. We do not sell to patients.

Beinaglutide Chemical Structure

Beinaglutide Chemical Structure

CAS No. : 123475-27-4

Size Price Stock Quantity
1 mg USD 135 In-stock
5 mg USD 300 In-stock
10 mg USD 490 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH)[1][2].

In Vitro

Beinaglutide (100 nM; 48 h) increases the expression of phosphorylation of Akt in the adipocytes that were potentiated insulin-stimulated[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Western Blot Analysis[2]

Cell Line: 3T3L-1 cells
Concentration: 100 nM
Incubation Time: 48 h
Result: Increased the phosphorylation of Akt in the adipocytes that were potentiated insulin-stimulated.
In Vivo

Beinaglutide (0.6, 1.2, 2.4 mg/kg; s.c.; three times per day for 7 consecutive days) shows the ability of glycemic contro, inhibits food intake and weight loss in mouse[1].
? Beinaglutide (150 μg/kg; s.c.; daily for 6 weeks) increases insulin sensitivity of adipocytes[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Wild-type male C57BL/6 mice and Male Lepob/Lepob (ob/ob) mice (ob/ob-NASH mouse model was induced by GAN diet)[1]
Dosage: 0.6, 1.2, 2.4 mg/kg
Administration: S.c.; three times per day for 7 consecutive days
Result: Significantly reduced blood glucose with dosedependence in C57BL/6 and ob/ob mice, dose dependently inhibits food intake and gastric Emptying, and significantly reduced body weight, food intake with dose-dependence.
Animal Model: Eight-week-old male C57BL/6 mice[2]
Dosage: 150 µg/kg
Administration: S.c.; daily for 6 weeks
Result: Showed improved glucose tolerance and insulin sensitivity, decreased adipose tissue weight and adipocyte size and potentiated insulin sensitivity of adipocytes.
Clinical Trial
Molecular Weight

3298.61

Formula

C149H225N39O46

CAS No.
Appearance

Solid

Color

White to off-white

Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

SMILES

C([C@@H](C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@@H](CCCNC(=N)N)C(O)=O)=O)=O)CCCCN)=O)C(C)C)=O)CC(C)C)=O)NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC2=CC=C(O)C=C2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC3=CC=CC=C3)NC([C@@H](NC(CNC([C@@H](NC([C@@H](NC([C@H](CC4=CN=CN4)N)=O)C)=O)CCC(O)=O)=O)=O)[C@@H](C)O)=O)=O)[C@@H](C)O)=O)CO)=O)CC(O)=O)=O)C(C)C)=O)CO)=O)CO)=O)=O)CC(C)C)=O)CCC(O)=O)=O)=O)CCC(N)=O)=O)C)=O)C)=O)CCCCN)=O)CCC(O)=O)=O)=O)[C@H](CC)C)=O)C)=O)C=5C=6C(NC5)=CC=CC6

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

DMSO : 1.79 mg/mL (0.54 mM; ultrasonic and adjust pH to 5 with HCl; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Beinaglutide
Cat. No.:
HY-P3463
Quantity:
MCE Japan Authorized Agent: