1. Recombinant Proteins
  2. Others
  3. 40S Ribosomal Protein S3/RPS3 Protein, Human (His)

40S Ribosomal Protein S3/RPS3 Protein, Human (His)

Cat. No.: HY-P72294
SDS COA Handling Instructions Technical Support

40S ribosomal protein S3 (RPS3) is an important component of the small ribosomal subunit and is integral to cellular protein synthesis. In addition to its ribosomal function, RPS3 exhibits endonuclease activity and plays a role in DNA repair. 40S Ribosomal Protein S3/RPS3 Protein, Human (His) is the recombinant human-derived 40S Ribosomal protein S3/RPS3 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

40S ribosomal protein S3 (RPS3) is an important component of the small ribosomal subunit and is integral to cellular protein synthesis. In addition to its ribosomal function, RPS3 exhibits endonuclease activity and plays a role in DNA repair. 40S Ribosomal Protein S3/RPS3 Protein, Human (His) is the recombinant human-derived 40S Ribosomal protein S3/RPS3 protein, expressed by E. coli , with C-His labeled tag.

Background

40S Ribosomal Protein S3 (RPS3), an integral component of the small ribosomal subunit, contributes to the cellular machinery responsible for protein synthesis. Apart from its ribosomal role, RPS3 exhibits endonuclease activity, participating in the repair of damaged DNA. Demonstrating broad substrate specificity, it cleaves phosphodiester bonds in DNAs containing altered bases and displays a higher efficiency in cleaving supercoiled DNA compared to relaxed DNA. RPS3 exhibits a strong affinity for 7,8-dihydro-8-oxoguanine (8-oxoG), a common DNA lesion induced by reactive oxygen species. Furthermore, it influences DNA repair processes by stimulating the activities of base excision proteins, such as OGG1 and UNG1, and promoting the cleavage of the phosphodiester backbone by APEX1. Beyond its role in DNA repair, RPS3 participates in various cellular functions, including transcriptional regulation as part of the NF-kappa-B p65-p50 complex, modulation of spindle formation and chromosome movement during mitosis through regulation of microtubule polymerization, and induction of apoptosis through interactions with key apoptotic factors like CASP8 and E2F1. Additionally, RPS3 has been implicated in protecting TP53/p53 from MDM2-mediated ubiquitination and negatively regulating DNA repair in response to hydrogen peroxide exposure.

Species

Human

Source

E. coli

Tag

C-His

Accession

P23396-1 (A2-A243)

Gene ID
Molecular Construction
N-term
RPS3 (A2-A243)
Accession # P23396-1
His
C-term
Synonyms
IMR 90 ribosomal protein S3
AA Sequence

AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

Molecular Weight

Approximately 32 kDa

Purity
  • Greater than 92% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

40S Ribosomal Protein S3/RPS3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
40S Ribosomal Protein S3/RPS3 Protein, Human (His)
Cat. No.:
HY-P72294
Quantity:
MCE Japan Authorized Agent: