Animal-Free I-TAC/CXCL11 Protein, Mouse (His)

The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. Animal-Free I-TAC/CXCL11 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeI-TAC/CXCL11 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free I-TAC/CXCL11 Protein, Mouse (His) is 79 a.a., with molecular weight of ~9.92 kDa.

CXCL11 protein exhibits specific chemotactic activity for interleukin-activated T-cells but not for unstimulated T-cells, neutrophils, or monocytes. Its capacity to induce calcium release specifically in activated T-cells suggests a targeted role in the immune response. By binding to CXCR3, CXCL11 is intricately involved in T-cell chemotaxis, indicating its potential significance in diseases of the central nervous system that involve T-cell recruitment. Furthermore, CXCL11 may contribute to skin immune responses, as inferred by similarities in its function. The interaction of CXCL11 with TNFAIP6 via the Link domain suggests a regulatory role, emphasizing its involvement in modulating chemokine activity within complex cellular microenvironments.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED₅₀ for this effect is <10 ng/mL.

Mouse

E. coli

N-His

Q9JHH5 (F22-M100)

56066  [NCBI]

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Approximately 9.92 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.