Apolipoprotein M/APOM Protein, Human (166a.a, HEK293, His)

Apolipoprotein M Protein, Human (166a.a, HEK293, His) expresses in HEK293, does not contain signal peptide sequence with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity ^[1].

Apolipoprotein E (apoE) is a 34-kDa glycoprotein that is a surface component of various plasma lipoprotein particles including chlyomicron remnants, β-migrating VLDL (β-VLDL), LDL, and a subclass of HDL. ApoE mediates high-affinity binding of apoE-containing lipoproteins to cell surface endocytic receptors during the transport and metabolism of plasma cholesterol (Chol) and triglycerides (TG). HEK-apoE is a ligand for low-density lipoprotein (LDL) receptor-related protein (LRP) but not the LDL receptor^[1].

Measured by its ability to bind all-trans-retinoic acid. The concentration of all-trans-retinoic acid required to quench 50% of Trp fluorescence in Recombinant Human Apolipoprotein M/ApoM is approximately 21.899-27.536 μM.

Human

HEK293

C-6*His

O95445 (C23-N188)

55937

CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

19-24 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.