Beta-NGF Protein, Human (HEK293)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss^[1][2][3]. Beta-NGF Protein, Human (HEK293) is produced by HEK293 cells (S122-R239), with tag free.

Nerve Growth Factor-β (Beta-NGF; NGF) is a basic protein of 118 amino acids which acts are a trophic factor for sensory and sympathetic neurons of the peripheral nervous system, and on cholinergic neurons of the anterior basal cerebrum^[1]. NGF involves in the regulation of neuronal survival and differentiation. Elevated levels of NGF are associated with the risk of post-traumatic stress disorder (PTSD). The trauma response leads to methylation of DNA nucleotides responsible for NGF expression. NGF levels have shown increased sympathetic fiber density proportional to NGF messenger RNA (mRNA) levels. NGF is also a seminal plasma protein commonly found in mammals. For example, NGF acts as an ovulation stimulating factor in camels and has been shown to have luteinizing effects in bulls. NGF has a potential function in the female reproductive system. For example, NGF plays an important role in ovulation induction, LH release, ovulation, luteal development, progesterone (P4) production, vascularization of luteal body, and gonadotropin response. Application of NGF to cattle enhances steroid production, luteal formation and function by increasing LH release, and leads to increased mRNA expression of markers of pregnancy and development downstream. In addition, the potential luteinizing effect of NGF could help overcome the current problem of early embryo loss^[2][3]. The similarity between human and bovine NGF protein sequence was 90.87%. Meanwhile, the similarity rate of human NGF with rat and mouse was 85.89% and 85.06%, respectively.

NGF (human; 100 ng/mL; 5 d) induces a dose-dependent increase in DNA synthesis of B cells^[4].

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is ≤2 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Fibronectin is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Rat CD157 Protein. The ED₅₀ for this effect is 4.274 μg/mL.

Human

HEK293

Tag Free

P01138 (S122-R239)

4803  [NCBI]

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

Approximately 13.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM PB, 250 mM NaCl, pH7.0 or 20 mM NaAC, 150 mM NaCl, pH 5.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yue XJ, et al. Over-expression of nerve growth factor-β in human cholangiocarcinoma QBC939 cells promote tumor progression. PLoS One. 2013;8(4):e62024. Published 2013 Apr 24.  [Content Brief]

  [2]. Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62(1):67-72.  [Content Brief]

  [3]. Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26(153):717-722.  [Content Brief]

  [4]. Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.  [Content Brief]

  [5]. Otten U, et al. Nerve growth factor induces growth and differentiation of human B lymphocytes. Proc Natl Acad Sci U S A. 1989 Dec;86(24):10059-63.  [Content Brief]