Cathepsin L1 Protein, Mouse (HEK293, His)

Cathepsin L Protein, Mouse (HEK293, His) is a lysosomal acid cysteine protease, which is associated with tumor occurrence, development, and metastasis.

Cathepsin L (CTSL) is a cysteine protease that belongs to the papain-like family (peptidase C1A), which is associated with tumor occurrence, development, and metastasis. Cathepsin L is implicated in invasion and metastasis of tumors, inflammatory status, atherosclerosis, renal disease, diabetes, bone diseases, viral infection and other diseases. Functions of Cathepsin L depend on their subcellular localization: Cathepsin L is involved in cell death and inflammation in the cytoplasm, and it also regulates cell cycle in the nucleus and exert degradative roles in the extracellular environment. Cathepsin L is expressed in all tissues and cell types and the primary function of cysteine cathepsins is proteolysis of protein antigens generated by pathogen endocytosis^[1][2].

Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC. The specific activity is 26159.6 pmol/min/µg, as measured under the described conditions.

Mouse

HEK293

C-His

P06797 (T18-N334)

13039  [NCBI]

TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNHHHHHH

Approximately 36.02 kDa.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5-8.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mei-Ling Han, et al. Cathepsin L upregulation-induced EMT phenotype is associated with the acquisition of cisplatin or paclitaxel resistance in A549 cells. Acta Pharmacol Sin. 2016 Dec;37(12):1606-1622.  [Content Brief]

  [2]. Caio P Gomes, et al. Cathepsin L in COVID-19: From Pharmacological Evidences to Genetics. Front Cell Infect Microbiol. 2020 Dec 8;10:589505.  [Content Brief]