1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins Endothelial cell CD Proteins
  4. LAMP3/CD63
  5. CD63 Protein, Human/Cynomolgus (HEK293, N-His)

CD63 Protein, Human/Cynomolgus (HEK293, N-His)

Cat. No.: HY-P72715
COA Handling Instructions

CD63 protein acts as a receptor for TIMP1, activating cell signaling pathways and promoting cell survival. It plays a key role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Human/Cynomolgus (HEK293, N-His) is the recombinant human-derived CD63 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $170 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD63 protein acts as a receptor for TIMP1, activating cell signaling pathways and promoting cell survival. It plays a key role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Human/Cynomolgus (HEK293, N-His) is the recombinant human-derived CD63 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

The CD63 Protein functions as a cell surface receptor for TIMP1, contributing to the activation of cellular signaling cascades. It plays a pivotal role in the activation of ITGB1 and subsequent integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. This multifaceted protein is involved in diverse cellular processes, including promoting cell survival, orchestrating the reorganization of the actin cytoskeleton, enhancing cell adhesion, spreading, and migration through its involvement in AKT and FAK/PTK2 activation. Furthermore, CD63 participates in VEGFA signaling by regulating the internalization of KDR/VEGFR2 and influences intracellular vesicular transport processes. Its indispensable role in the trafficking of the PMEL luminal domain is crucial for the development and maturation of melanocytes. Additionally, CD63 contributes to leukocyte adhesion onto endothelial cells by regulating SELP trafficking. While it may play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, it appears to be dispensable for degranulation in response to other stimuli. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, the latter being essential for recruiting KDR to ITGB1 complexes, further emphasizing its intricate role in cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 2.5 μg/mL (100 μL/well). The ED50 for this effect is 2.134 μg/mL corresponding to a specific activity is 4.69×10^3 Unit/mg.

Species

Human; Cynomolgus

Source

HEK293

Tag

N-6*His

Accession

P08962-1/NP_001253224 (A103-V203)

Gene ID

967  [NCBI]/709828

Molecular Construction
N-term
6*His
CD63 (A103-V203)
Accession # P08962-1/NP_001253224
C-term
Synonyms
CD63 antigen; LAMP-3; Tspan-30; CD63; MLA1; TSPAN30
AA Sequence

AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

Molecular Weight

20-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD63 Protein, Human/Cynomolgus (HEK293, N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD63 Protein, Human/Cynomolgus (HEK293, N-His)
Cat. No.:
HY-P72715
Quantity:
MCE Japan Authorized Agent: