1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD319/SLAMF7 Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. CD319/SLAMF7
  5. CRACC/SLAMF7 Protein, Human (HEK293, His)

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (HEK293, His) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (HEK293, His) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CRACC/SLAMF7 protein, as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, participates in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of various immune cells, intricately contributing to the regulation and interconnection of both innate and adaptive immune responses. The protein's activities are finely tuned by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. Specifically, isoform 1 of CRACC/SLAMF7 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway, positively regulating NK cell functions in a mechanism dependent on phosphorylated SH2D1B. Downstream signaling involves PLCG1, PLCG2, and PI3K. Additionally, homotypic interactions between NK cells may contribute to activation, but in the absence of SH2D1B, CRACC/SLAMF7 inhibits NK cell function. The protein also acts as an inhibitory factor in T-cells and may play a role in lymphocyte adhesion. In LPS-activated monocytes, it negatively regulates the production of pro-inflammatory cytokines. However, isoform 3 of CRACC/SLAMF7 does not mediate any NK cell activation, indicating isoform-specific functional differences in immune modulation.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NQ25-1 (S23-M226)

Gene ID
Molecular Construction
N-term
CRACC (S23-M226)
Accession # Q9NQ25-1
6*His
C-term
Synonyms
SLAM Family Member 7; CD2 Subset 1; CRACC; CD319; SLAMF7; CS1
AA Sequence

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Molecular Weight

35-44 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CRACC/SLAMF7 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRACC/SLAMF7 Protein, Human (HEK293, His)
Cat. No.:
HY-P72460
Quantity:
MCE Japan Authorized Agent: