Ephrin-B1/EFNB1 Protein, Mouse (HEK293, His)

Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-His labeled tag.

Ephrin-B1/EFNB1, a cell surface transmembrane ligand for Eph receptors, plays a pivotal role in mediating contact-dependent bidirectional signaling during neuronal, vascular, and epithelial development. With high affinity for the receptor tyrosine kinase EPHB1/ELK, it also binds to EPHB2 and EPHB3. Binding to Eph receptors on neighboring cells initiates bidirectional signaling crucial for migration, repulsion, and adhesion. Additionally, EFNB1 is involved in inducing the collapse of commissural axons/growth cones in vitro and may contribute to constraining the orientation of longitudinally projecting axons. The protein interacts with GRIP1 and GRIP2 through its PDZ-binding motif and associates with TLE1. Moreover, the intracellular domain peptide of EFNB1 interacts with ZHX2, enhancing ZHX2's transcriptional repression activity.

Mouse

HEK293

C-His

P52795/NP_034240.1 (K30-S229)

13641  [NCBI]

MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

33-38 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.