FABP3 Protein, Human (His)

FABP3 Protein, Human (His) is a recombinant FABP3 protein with a His-flag. FABP3 Protein is expressed in the skeletal muscle, heart, brain and brown adipose tissue^[1].

Fatty acid binding proteins (FABPs) are intracellular proteins and exhibit high affinity for small lipophilic ligands. FABP-3 is expressed in the skeletal muscle, heart, brain and brown adipose tissue. And its expression in skeletal muscles is elevated on consumption of a high fat diet. The gene encoding it is localized on human chromosome 1p35.
FABP3 is a newly introduced plasma marker of acute myocardial infarction (AMI). FABP3 is identified as a novel selective autophagy substrate of OPTN (optineurin, a macroautophagy/autophagy receptor, is found to play a pivotal role in selective autophagy, coupling autophagy with bone metabolism). FABP3 promotes adipogenesis and inhibits osteogenesis of MSCs. Knockdown of FABP3 alleviates bone loss in optn-/ - mice and aged mice^[1][2].

Human

E. coli

N-6*His

P05413 (V2-A133)

2170  [NCBI]

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Seung-Min Lee, et al. FABP3-mediated membrane lipid saturation alters fluidity and induces ER stress in skeletal muscle with aging. Nat Commun. 2020 Nov 9;11(1):5661.  [Content Brief]

  [2]. Zheng-Zhao Liu, et al. Autophagy receptor OPTN (optineurin) regulates mesenchymal stem cell fate and bone-fat balance during aging by clearing FABP3. Autophagy. 2020 Nov 4;1-17.  [Content Brief]