FGF-23 Protein, Human (R179Q, HEK293, His)

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 Protein, Human (R179Q, HEK293, His) is the recombinant human-derived FGF-23 protein, expressed by HEK293 , with C-His labeled tag and R179Q, , , , mutation.

FGF-23 protein functions as a crucial regulator of phosphate homeostasis, as evidenced by its ability to inhibit renal tubular phosphate transport through the reduction of SLC34A1 levels. Additionally, it plays a role in up-regulating EGR1 expression in the presence of KL and acts directly on the parathyroid to decrease PTH secretion. This protein is involved in the regulation of vitamin-D metabolism and acts as a negative regulator of osteoblast differentiation and matrix mineralization. The interaction of FGF-23 with FGFR1, FGFR2, FGFR3, and FGFR4 further underscores its significance in cellular processes. Furthermore, the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by KL and heparan sulfate glycosaminoglycans, serving as crucial coreceptors in this regulatory network.

Determined by its ability to stimulate the proliferation of NIH-3T3 cells. The ED₅₀ for this effect is 14.84 ng/mL in the presence of 1μg/mL murine Klotho and 100μg/mL heparin, corresponding to a specific activity is 6.739×10⁴ units/mg.

• 
  Determined by its ability to stimulate the proliferation of NIH-3T3 cells. The ED₅₀ for this effect is 14.84 ng/mL in the presence of 1μg/mL murine Klotho and 100μg/mL heparin, corresponding to a specific activity is 6.739×10⁴ units/mg.

Human

HEK293

C-6*His

Q9GZV9 (Y25-I251, R179Q)

8074  [NCBI]

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Approximately 29-32 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.