1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Rat (HEK293)

G-CSF Protein, Rat (HEK293)

Cat. No.: HY-P7093A
COA Handling Instructions

G-CSF Protein, Rat (HEK293) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $50 In-stock
10 μg $140 In-stock
50 μg $390 In-stock
100 μg $665 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

G-CSF Protein, Rat (HEK293) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells.

Background

G-CSF is a glycoprotein, secreted by the cells of the immune system, fibroblasts, and endothelium and functions to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells. G-CSF conveys neuroprotection to central neurons upon increases in phosphorylation of PI3K/Akt pathway, and regulates epithelial to mesenchymal transition in cancer[1]. G-CSF acts via a specific cognate receptor (G-CSFR) that belongs to the class I cytokine receptor superfamily. G-CSF is well known as a hematopoietic cytokine that stimulates the proliferation, differentiation, and function of myeloid progenitors and mobilization of hematopoietic stem and progenitor cells[2]. G-CSF has the potential to inhibit the progression of atherosclerosis in animal models[3].

Biological Activity

Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells.The ED50 is ≤ 16.25 pg/mL, corresponding to a specific activity of ≥ 6.15 × 107 units/mg.

  • Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells.The ED50 is < 5 pg /mL, corresponding to a specific activity of > 2 × 108 units/mg.
Species

Rat

Source

HEK293

Tag

Tag Free

Accession

P97712 (I22-I214)

Gene ID
Molecular Construction
N-term
G-CSF (I22-I214)
Accession # P97712
C-term
Synonyms
rRtG-CSF; CSF-3; MGI-1G; Pluripoietin; Molgramostin; Sargramostim
AA Sequence

IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI

Molecular Weight

25-33 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB,150 mM NaCl, pH 7.8.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

G-CSF Protein, Rat (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
G-CSF Protein, Rat (HEK293)
Cat. No.:
HY-P7093A
Quantity:
MCE Japan Authorized Agent: