1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. HPGDS Protein, Human

HPGDS protein is a multifunctional enzyme with bifunctionality, and its C-terminal and N-terminal domains have different activities.The C terminus acts as an epoxide hydrolase, promoting xenobiotic metabolism by degrading harmful epoxides and regulating physiological mediator levels.HPGDS Protein, Human is the recombinant human-derived HPGDS protein, expressed by E.coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg USD 180 Ask For Quote & Lead Time
50 μg USD 500 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HPGDS protein is a multifunctional enzyme with bifunctionality, and its C-terminal and N-terminal domains have different activities.The C terminus acts as an epoxide hydrolase, promoting xenobiotic metabolism by degrading harmful epoxides and regulating physiological mediator levels.HPGDS Protein, Human is the recombinant human-derived HPGDS protein, expressed by E.coli , with tag free.

Background

EPHX2, a multifunctional enzyme, exhibits bifunctionality with distinct activities in its C-terminal and N-terminal domains. The C-terminal domain functions as an epoxide hydrolase, targeting both alkene oxides and arene oxides, contributing to xenobiotic metabolism by degrading potentially harmful epoxides. Additionally, it plays a role in modulating the steady-state levels of physiological mediators. On the other hand, the N-terminal domain showcases lipid phosphatase activity, with a preference for substrates like threo-9,10-phosphonooxy-hydroxy-octadecanoic acid and erythro-9,10-phosphonooxy-hydroxy-octadecanoic acid. It also demonstrates phosphatase activity towards lyso-glycerophospholipids, with varying activity towards lysolipids of sphingolipid and isoprenoid phosphates. The versatile functions of EPHX2 contribute to its involvement in diverse biological processes, reflecting its significance in cellular homeostasis.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O60760 (M1-L199)

Gene ID
Molecular Construction
N-term
HPGDS (M1-L199)
Accession # O60760
C-term
Synonyms
Glutathione-Dependent PGD Synthase; Glutathione-Requiring Prostaglandin D Synthase; Prostaglandin-H2 D-Isomerase; HPGDS; GSTS; PGDS; PTGDS2
AA Sequence

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

Molecular Weight

Approximately 26.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HPGDS Protein, Human Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HPGDS Protein, Human
Cat. No.:
HY-P71036
Quantity:
MCE Japan Authorized Agent: