HPGDS Protein, Human

HPGDS protein is a multifunctional enzyme with bifunctionality, and its C-terminal and N-terminal domains have different activities.The C terminus acts as an epoxide hydrolase, promoting xenobiotic metabolism by degrading harmful epoxides and regulating physiological mediator levels.HPGDS Protein, Human is the recombinant human-derived HPGDS protein, expressed by E.coli , with tag free.

EPHX2, a multifunctional enzyme, exhibits bifunctionality with distinct activities in its C-terminal and N-terminal domains. The C-terminal domain functions as an epoxide hydrolase, targeting both alkene oxides and arene oxides, contributing to xenobiotic metabolism by degrading potentially harmful epoxides. Additionally, it plays a role in modulating the steady-state levels of physiological mediators. On the other hand, the N-terminal domain showcases lipid phosphatase activity, with a preference for substrates like threo-9,10-phosphonooxy-hydroxy-octadecanoic acid and erythro-9,10-phosphonooxy-hydroxy-octadecanoic acid. It also demonstrates phosphatase activity towards lyso-glycerophospholipids, with varying activity towards lysolipids of sphingolipid and isoprenoid phosphates. The versatile functions of EPHX2 contribute to its involvement in diverse biological processes, reflecting its significance in cellular homeostasis.

Human

E. coli

Tag Free

O60760 (M1-L199)

27306  [NCBI]

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

Approximately 26.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.