1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278 ICOS/CD278
  5. ICOS Protein, Rhesus macaque (HEK293,Fc)

ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293,Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ICOS Protein, Rhesus macaque (HEK293,Fc) is 121 a.a., with molecular weight of 50-60 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293,Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ICOS Protein, Rhesus macaque (HEK293,Fc) is 121 a.a., with molecular weight of 50-60 kDa.

Background

The ICOS protein plays a crucial role in enhancing all fundamental T-cell responses to foreign antigens, including promoting cell proliferation, secretion of lymphokines, up-regulation of molecules involved in cell-cell interaction, and facilitating effective help for antibody secretion by B-cells. It is indispensable for facilitating efficient communication between T and B-cells, as well as for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it has the ability to superinduce the synthesis of interleukin-10. Additionally, ICOS prevents the apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. It exists as a homodimer connected by disulfide bonds.

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

H9Z062 (G20-K140)

Gene ID
Molecular Construction
N-term
ICOS (G20-K140)
Accession # H9Z062
hFc
C-term
Synonyms
rRhInducible T-cell costimulator/ICOS, Fc ; Inducible T-cell costimulator; activation-inducible lymphocyte immunomediatory molecule; CD278; AILIM; CVID1; ICOS
AA Sequence

GEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Molecular Weight

50-60 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ICOS Protein, Rhesus macaque (HEK293,Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Rhesus macaque (HEK293,Fc)
Cat. No.:
HY-P70187
Quantity:
MCE Japan Authorized Agent: